Comparing PfGW456L13_3037 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
33% identity, 89% coverage: 6:449/498 of query aligns to 5:473/506 of 3i8bA
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 98% coverage: 6:493/498 of query aligns to 1:474/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
32% identity, 98% coverage: 6:493/498 of query aligns to 1:466/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 89% coverage: 3:444/498 of query aligns to 1:437/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 89% coverage: 4:444/498 of query aligns to 1:435/490 of 3ll3B
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
26% identity, 88% coverage: 10:449/498 of query aligns to 9:456/498 of 3kzbA
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
22% identity, 99% coverage: 1:493/498 of query aligns to 1:495/501 of O34154
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
25% identity, 93% coverage: 7:469/498 of query aligns to 5:459/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
25% identity, 93% coverage: 7:469/498 of query aligns to 5:459/478 of 5ya1A
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
22% identity, 97% coverage: 8:491/498 of query aligns to 4:524/546 of 3qdkA
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
22% identity, 89% coverage: 3:444/498 of query aligns to 6:456/507 of 2w41B
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
22% identity, 89% coverage: 4:444/498 of query aligns to 1:450/501 of 2w40A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
24% identity, 89% coverage: 8:449/498 of query aligns to 2:436/485 of 6k76A
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
21% identity, 100% coverage: 1:496/498 of query aligns to 1:492/506 of O34153
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
22% identity, 94% coverage: 5:470/498 of query aligns to 4:472/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
22% identity, 94% coverage: 5:470/498 of query aligns to 3:471/498 of Q5HGD2
3h3nX Glycerol kinase h232r with glycerol (see paper)
21% identity, 98% coverage: 8:496/498 of query aligns to 7:491/501 of 3h3nX
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
22% identity, 98% coverage: 5:494/498 of query aligns to 3:494/494 of 1gllO
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
22% identity, 98% coverage: 5:494/498 of query aligns to 3:494/494 of 1gljO
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
22% identity, 98% coverage: 5:494/498 of query aligns to 3:494/494 of 1bwfO
>PfGW456L13_3037 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3037
MTTLQLFLGIDCGTQGTKAIILDSANGEVLGQGTASHSLISGPNGRREQDTQQWLEAFAT
ATRRALLAAKTNGQSILGIGVSGQQHGLVLLDDQGKVLRAAKLWCDTETTPENDRLLAHL
GGEKGSLKRLGVVIAPGYTLSKLLWTKEQHPEVFSRISRILLPHDYLNHWLTGRSCSEYG
DASGTGYFNVRTRQWDGQLLRDIDPSGRLQAALPELIAPHQAVGTILPGIAEHLGINPRA
LVSSGGGDNMMGAIGTGNIQPGAITMSLGSSGTVYAYADQPNVATDAAVATFCSSSGGWL
PLICTMNLTNATSLIRELLDLDIDQFNDLVAQAPIGADGVCMLPFFNGERVPALPHASAS
LSGLTMTNLTRANLCRAVVEGTTFGLRYGLDLLRRNGLQSRSIRLIGGGSKSAVWRQIVA
DTMNTPVICTEQSEAAALGAAIQAAWCVSRANGHEDSLAQLCERCVKLDPASETLPVADN
VQACQQAYERYQQHVATL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory