Comparing PfGW456L13_3038 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3038 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
85% identity, 100% coverage: 1:489/490 of query aligns to 1:489/492 of 1m2wA
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
85% identity, 100% coverage: 1:489/490 of query aligns to 1:489/492 of 1lj8A
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
44% identity, 100% coverage: 1:489/490 of query aligns to 3:498/501 of 7rk5B
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
39% identity, 97% coverage: 11:487/490 of query aligns to 3:479/483 of 4im7A
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
25% identity, 41% coverage: 175:374/490 of query aligns to 105:293/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
25% identity, 43% coverage: 164:374/490 of query aligns to 95:294/388 of Q4X1A4
>PfGW456L13_3038 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3038
MKLNQLNLNRLAPEVVLPAYALGETRQGIAHIGVGGFHRAHQAYYTDALMNTGEGLDWAI
CGVGLRAEDRRARDDLKDQDYLFTLFELGDSGDTEVRVIGALRDMLLAEDSAQALIDKLA
SPEIRIVSLTITEGGYCIDDSTGEFMAHLPQIQHDLAHPGAPKTVFGFLCAALAKRRAAG
TAAFTLMSCDNLPHNGAVTRKALLAFAALHDSQLRDWIDTNVSFPNAMVDRITPMTSTLH
RLQLADRHGVDDAWPVVCEPFAQWVLEDRFVNGRPAWEKVGVQFTDDVTPYEEMKIKLLN
GSHLALTYLGFLKGYRFVHEAMNDPLFVRYMRAYMDLDVTPQLPAVPGIDLAEYKNTLVA
RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIADGCDTRRAALVVAAWALYLKGVDEQ
GETYTIADPRAAFCQALVADDVLITQRLLAVEEIFGTAIARSPEFVAAFEWCCNSLREVG
VSRTLERVLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory