Comparing PfGW456L13_3042 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3042 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
64% identity, 95% coverage: 23:436/436 of query aligns to 1:417/417 of 4ryaA
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
29% identity, 70% coverage: 21:326/436 of query aligns to 3:311/399 of 5iaiA
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
28% identity, 89% coverage: 46:431/436 of query aligns to 27:407/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
28% identity, 89% coverage: 46:431/436 of query aligns to 68:448/450 of Q7LYW7
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
24% identity, 76% coverage: 96:427/436 of query aligns to 75:389/393 of 5ci5A
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
25% identity, 75% coverage: 7:332/436 of query aligns to 14:335/416 of A9CEY9
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
25% identity, 66% coverage: 46:332/436 of query aligns to 25:307/389 of 7ofyA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
26% identity, 66% coverage: 46:332/436 of query aligns to 22:302/382 of 7yzuA
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
27% identity, 69% coverage: 17:316/436 of query aligns to 2:303/406 of 7ehqA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
25% identity, 66% coverage: 46:332/436 of query aligns to 23:305/384 of 7yzsAAA
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 66% coverage: 46:332/436 of query aligns to 24:305/390 of 7qhvAAA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
23% identity, 87% coverage: 39:418/436 of query aligns to 18:380/391 of 6dtqA
Sites not aligning to the query:
1eljA The crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus (see paper)
24% identity, 66% coverage: 39:326/436 of query aligns to 22:291/380 of 1eljA
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 84% coverage: 66:431/436 of query aligns to 42:381/387 of 5ysdA
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
24% identity, 84% coverage: 66:431/436 of query aligns to 41:380/386 of 5ysbA
Sites not aligning to the query:
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 84% coverage: 66:431/436 of query aligns to 42:381/389 of 5ysdB
Sites not aligning to the query:
7v09A Crystal structure of ecl_rs08780, putative sugar transport system periplasmic sugar-binding protein
27% identity, 51% coverage: 39:260/436 of query aligns to 20:238/403 of 7v09A
Sites not aligning to the query:
4zs9B Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with raffinose (see paper)
32% identity, 31% coverage: 39:172/436 of query aligns to 17:145/378 of 4zs9B
Sites not aligning to the query:
4zs9A Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with raffinose (see paper)
32% identity, 31% coverage: 39:172/436 of query aligns to 17:144/377 of 4zs9A
Sites not aligning to the query:
4zzeA Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with panose (see paper)
32% identity, 31% coverage: 39:172/436 of query aligns to 17:144/377 of 4zzeA
Sites not aligning to the query:
>PfGW456L13_3042 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3042
MQPSVKALLALTCMTLSSVSLGAQTLTIATVNNSDMIRMQKLSKTFEAEHPDIKLNWVVL
EENVLRQRLTTDIATQGGQFDVLTIGMYEAALWGAKGWLEPMKDLPAGYALDDVFASVRE
GLSVKGQLYALPFYAESSITYYRTDLFKDAGLTMPERPTWEQIGEFAAKLNKPEQEQYGI
CLRGKAGWGENIALISTVANAYGARWFDEKWQPEFNGPEWKNALNFYVDTMKKSGPPGAS
SNGFNENLALFNSGKCAIWVDASVAGSFVTDKSQSKVTDHVGFTYAPHQVTDKGSAWLYS
WALAIPTSSKAKDAAKTFSAWATSKEYGALVAEKDGIANVPPGTRASTYSEAYMSAAPFA
RVTLESLKAADPSKPGTRPVPYIGIQLVTIPEFQGIGTQVGKSFSAALIGQTTVDQALAA
AQQTTEREMKRAGYPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory