Comparing PfGW456L13_3114 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3114 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
3oa4A Crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125
37% identity, 44% coverage: 36:98/144 of query aligns to 41:101/138 of 3oa4A
Sites not aligning to the query:
>PfGW456L13_3114 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3114
MDGLLKLGIGPWRVYTFSPENTENQTYHGEPAEFVLKVCFAQSGNMVWELMEPVSGPTIF
ADFLEKHGEGIQHVAYDCNNIPFEDRITELTRRGFKCVQSGSWMGVNHFAFFGTEADTTT
VFETYAFPSDWDYPEPEAWYPAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory