SitesBLAST – Find functional sites

 

SitesBLAST

Comparing PfGW456L13_3149 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3149 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 2 hits to proteins with known functional sites (download)

8wm8B Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with nitrate (see paper)
26% identity, 57% coverage: 120:281/282 of query aligns to 100:265/265 of 8wm8B

query
sites
8wm8B
P
 
P
S
 
L
F
 
V
D
 
Y
R
 
N
V
 
A
V
 
V
D
 
D
P
 
P
F
 
I
L
 
F
D
 
Q
L
 
V
I
 
L
Q
 
R
T
 
T
M
 
V
P
 
P
P
 
P
Y
 
L
I
 
A
Y
 
W
L
 
L
L
 
P
P
 
I
A
 
S
I
 
L
A
 
A
L
 
A
L
 
F
G
 
Q
Y
 
Q
G
 
A
T
 
N
A
 
P
T
 
S
A
 
A
L
 
I
L
 
F
A
 
V
T
 
I
F
 
F
I
 
I
V
 
T
A
 
S
V
 
I
P
 
W
P
 
P
A
 
I
M
 
L
R
 
L
L
 
N
T
 
T
S
 
T
L
 
V
G
 
G
I
 
V
R
 
Q
M
 
Q
T
 
I
P
 
P
K
 
Q
E
 
D
F
 
Y
I
 
I
E
 
N
L
 
V
G
 
A
D
 
K
A
 
V
S
 
L
G
 
R
V
 
L
T
 
K
G
 
G
W
 
V
Q
 
K
M
 
Y
F
 
F
F
 
F
K
 
K
I
 
I
R
 
V
L
 
F
P
 
P
F
 
A
A
 
T
M
 
V
P
 
P
S
 
Y
I
 
I
M
 
F
A
 
T
G
 
G
V
 
L
N
 
R
Q
 
I
S
 
G
L
 
I
M
 
G
M
 
L
A
 
S
F
 
W
G
x
L
M
 
A
V
 
I
V
 
V
I
x
A
A
 
A
G
 
E
-
 
M
I
 
L
V
 
V
G
 
G
S
 
G
G
 
V
G
 
G
L
 
I
G
 
G
E
 
S
S
 
F
I
 
I
Y
 
W
G
 
D
A
 
A
V
 
Y
R
 
N
T
 
T
-
 
T
-
 
T
-
 
E
L
 
T
D
 
N
I
 
L
A
 
S
K
 
E
S
 
I
I
 
I
N
 
L
A
 
A
A
 
L
I
 
I
A
 
Y
I
 
V
V
 
G
I
 
L
L
 
V
T
 
G
M
 
L
I
 
L
L
 
L
D
 
D
R
 
R
L
 
L
A
 
V
Q
 
G
S
 
F
A
 
V
A
 
A
R
 
S
S
 
K
R
 
V
M
 
V
G
 
A
E
 
D
S
 
Q

A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
36% identity, 39% coverage: 132:240/282 of query aligns to 60:168/506 of A0A0H2ZQB9

query
sites
A0A0H2ZQB9
L
 
I
I
 
F
Q
 
Q
T
 
T
M
 
I
P
 
P
P
 
S
Y
 
L
I
 
A
Y
 
L
L
 
L
L
 
G
P
 
L
A
 
F
I
 
I
A
 
P
L
 
L
L
 
M
G
 
G
Y
 
I
G
 
G
T
 
T
A
 
L
T
 
P
A
 
A
L
 
L
L
 
T
A
 
A
T
 
L
F
 
V
I
 
I
V
 
Y
A
 
A
V
 
I
P
 
F
P
 
P
A
 
I
M
 
L
R
 
Q
L
 
N
T
 
T
S
 
I
L
 
T
G
 
G
I
 
L
R
 
K
M
 
G
T
 
I
P
 
D
K
 
P
E
 
S
F
 
L
I
 
Q
E
 
E
L
 
A
G
 
G
D
 
I
A
 
A
S
 
F
G
 
G
V
 
M
T
 
T
G
 
R
W
 
W
Q
 
E
M
 
R
F
 
L
F
 
K
K
 
K
I
 
F
R
 
E
L
 
I
P
 
P
F
 
L
A
 
A
M
 
M
P
 
P
S
 
V
I
 
I
M
 
M
A
 
S
G
 
G
V
 
I
N
 
R
Q
 
T
S
 
A
L
 
A
M
 
V
M
 
L
A
 
I
F
 
I
G
 
G
M
 
T
V
 
A
V
 
T
I
 
L
A
 
A
G
 
T
I
 
L
V
 
I
G
 
G
S
 
A
G
 
G
G
 
G
L
 
L
G
 
G
E
 
S
S
 
F
I
 
I

Sites not aligning to the query:

Query Sequence

>PfGW456L13_3149 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3149
MSTPDFSSQFDSVVDSSLEWLMDNGESVFDTTNTFLKGVYEGVQWCIAYPPYYVIAIAIA
LIGWRAVGLRFAILTGLALLFCDVIGLWPETVSTLALVLTSTVLALVVAIPLGVLAGLAP
SFDRVVDPFLDLIQTMPPYIYLLPAIALLGYGTATALLATFIVAVPPAMRLTSLGIRMTP
KEFIELGDASGVTGWQMFFKIRLPFAMPSIMAGVNQSLMMAFGMVVIAGIVGSGGLGESI
YGAVRTLDIAKSINAAIAIVILTMILDRLAQSAARSRMGESK

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory