SitesBLAST
Comparing PfGW456L13_3223 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3223 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 82% coverage: 32:387/433 of query aligns to 25:364/383 of 5i39A
- active site: F66 (≠ N73), Q69 (= Q76), A70 (≠ L77), Q248 (vs. gap), P267 (≠ C284)
- binding flavin-adenine dinucleotide: V30 (= V37), G31 (= G38), G33 (= G40), I34 (≠ F41), L35 (≠ T42), V53 (≠ L60), E54 (= E61), K55 (≠ A62), Q62 (≠ A69), S63 (= S70), F66 (≠ N73), Y67 (≠ G74), Q69 (= Q76), A196 (≠ P212), A197 (≠ V213), G226 (≠ C240), G227 (≠ N241), W229 (≠ H243), Q248 (vs. gap), Q250 (≠ S260), G321 (= G343), M323 (≠ I345), T348 (≠ S371), G349 (= G372), W350 (≠ H373), G351 (= G374), M352 (≠ L375), T353 (≠ N376)
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
24% identity, 89% coverage: 22:405/433 of query aligns to 36:430/866 of Q9UI17
- CV 59:60 (≠ FT 41:42) binding
- EK 80:81 (≠ EA 61:62) binding
- 87:95 (vs. 68:76, 22% identical) binding
- H91 (≠ R72) modified: Tele-8alpha-FAD histidine
- H109 (≠ G93) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V213) binding
- S279 (= S269) to P: in dbSNP:rs532964
- F-GYGII 397:402 (≠ YSGHGLN 370:376) binding
Sites not aligning to the query:
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 80% coverage: 49:395/433 of query aligns to 22:357/374 of 1y56B
- active site: F44 (≠ G71), G47 (= G74), T48 (≠ G75), H224 (≠ S260), P239 (≠ V281), G305 (= G343), M338 (≠ N376)
- binding flavin-adenine dinucleotide: I33 (≠ L60), E34 (= E61), K35 (≠ A62), S42 (≠ A69), T43 (≠ S70), R45 (= R72), C46 (≠ N73), G47 (= G74), G49 (= G80), E170 (≠ P212), V171 (= V213), T200 (≠ C240), N201 (= N241), W203 (≠ H243), G305 (= G343), Y306 (≠ K344), Y307 (≠ I345), G334 (= G372), H335 (= H373), G336 (= G374), F337 (≠ L375), M338 (≠ N376)
- binding flavin mononucleotide: F44 (≠ G71), R45 (= R72), I260 (≠ L301), R301 (≠ Y339), W303 (= W341)
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
27% identity, 48% coverage: 32:240/433 of query aligns to 6:204/824 of 4pabB
- active site: T53 (≠ I78), E102 (≠ A140)
- binding flavin-adenine dinucleotide: I11 (≠ V37), G12 (= G38), G14 (= G40), C15 (≠ F41), V16 (≠ T42), L35 (= L60), E36 (= E61), K37 (≠ A62), G43 (= G68), S44 (≠ A69), T45 (≠ S70), H47 (≠ R72), A48 (≠ N73), A49 (≠ G74), G50 (= G75), L51 (≠ Q76), V175 (= V213), A204 (≠ C240)
Sites not aligning to the query:
- active site: 226, 255, 536
- binding flavin-adenine dinucleotide: 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 48% coverage: 32:240/433 of query aligns to 43:241/857 of Q63342
- CV 52:53 (≠ FT 41:42) binding
- EK 73:74 (≠ EA 61:62) binding
- 80:88 (vs. 68:76, 22% identical) binding
- H84 (≠ R72) modified: Tele-8alpha-FAD histidine
- V212 (= V213) binding
Sites not aligning to the query:
- 244 binding
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
26% identity, 48% coverage: 32:239/433 of query aligns to 17:217/433 of 5hxwA
- active site: F58 (≠ N73), Q61 (= Q76), A62 (≠ L77)
- binding flavin-adenine dinucleotide: V22 (= V37), G23 (= G38), G25 (= G40), I26 (≠ F41), L27 (≠ T42), E46 (= E61), K47 (≠ A62), E53 (≠ G68), Q54 (≠ A69), S55 (= S70), R57 (= R72), F58 (≠ N73), Y59 (≠ G74), G60 (= G75), Q61 (= Q76), A188 (≠ P212), A189 (≠ V213)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 218, 219, 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Query Sequence
>PfGW456L13_3223 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3223
MNQYTKEHTHSYYAASAKGMRQRPALASDLVADVCVVGAGFTGINTAIELAQRGLSVVLL
EARRIGWGASGRNGGQLIRGIGHDVSGFAKHIGADGVQYLEHAGNESVQVVANRIREHGI
DCDLSWGFCELANTPAQFKALKAEQVQLIESGYAFETRLVAPEQIREQVVNSGVYAGGLV
DMGSGHLHPLNLVLGEAQVAESLGVRIFEQSPVLELIHGSTVQVRCAGGTVSAGTLVLAC
NAHLEELEPKLSGKVLPAGSYIIATEPLSQEAAAKLIPHNVALCDQKVGLDYYRLSADRR
LLFGGACHYSGRDPSDISAYMRPQMLKVFPQLADVRIDYQWGGKIGISANRFPQVGRLSQ
HPNVFYAQGYSGHGLNVTHWCAKLLGEAIHAGHSKGFDVFSAVPHMTFPGGRALRSPLLA
LGMFWYRMREMLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory