Comparing PfGW456L13_324 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_324 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7yleA Rndmpx in complex with dmsp (see paper)
24% identity, 89% coverage: 35:322/322 of query aligns to 5:297/299 of 7yleA
Q5LT66 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
22% identity, 97% coverage: 1:311/322 of query aligns to 18:332/333 of Q5LT66
Sites not aligning to the query:
P0AFM2 Glycine betaine/proline betaine-binding periplasmic protein; GBBP from Escherichia coli (strain K12) (see 2 papers)
31% identity, 46% coverage: 77:224/322 of query aligns to 73:211/330 of P0AFM2
Sites not aligning to the query:
1r9qA Structure analysis of prox in complex with proline betaine (see paper)
31% identity, 46% coverage: 77:224/322 of query aligns to 52:190/309 of 1r9qA
Sites not aligning to the query:
4xz6A Tmox in complex with tmao (see paper)
20% identity, 88% coverage: 30:311/322 of query aligns to 1:290/291 of 4xz6A
2rinA Abc-transporter choline binding protein in complex with acetylcholine (see paper)
23% identity, 89% coverage: 30:316/322 of query aligns to 1:273/288 of 2rinA
2regA Abc-transporter choline binding protein in complex with choline (see paper)
23% identity, 89% coverage: 30:316/322 of query aligns to 3:275/290 of 2regA
Q4FL33 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Pelagibacter ubique (strain HTCC1062) (see paper)
23% identity, 95% coverage: 1:306/322 of query aligns to 1:309/314 of Q4FL33
>PfGW456L13_324 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_324
MKSNKTLLTALLSMGLLASAGATQAAGWCESGKPVKFAGLNWESAMLLTDVMQVVLEKGY
DCKTDSLPGNSITMENALSSNDIQVFAEEWVGRSEVWNKAEKAGKVVGVGAPVVGAIEGW
YVPRYVIEGDAKRKLEAKAPDLKNIADLGKYSAVFKDAEEPSKGRFYNCPAGWTCELDNS
EMLKSYGLESTYTNFRPGTGPALDAAVLSSYKRGEPILFYYWSPTPLMGQIDAVKLEEKP
GVNKTVTIKVGLSKTFHDEAPELVAVLEKVNVPIDLLNQNLGRMTKERIESPKLAKIFLK
EHPEVWHAWVSEDAAKKIDAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory