Comparing PfGW456L13_3289 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3289 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
70% identity, 94% coverage: 6:168/173 of query aligns to 2:165/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
46% identity, 61% coverage: 60:164/173 of query aligns to 57:160/164 of 2ge3A
Sites not aligning to the query:
P0A951 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 84% coverage: 1:145/173 of query aligns to 1:144/186 of P0A951
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/170 of 6e1xA
Sites not aligning to the query:
6cx8A Crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.
32% identity, 72% coverage: 21:145/173 of query aligns to 18:143/173 of 6cx8A
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/170 of 4r87A
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/170 of 4r57A
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/170 of 4nczA
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/170 of 4mi4A
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/170 of 4mhdA
Q9KL03 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
32% identity, 72% coverage: 21:145/173 of query aligns to 18:143/173 of Q9KL03
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
32% identity, 72% coverage: 21:145/173 of query aligns to 21:146/176 of 6e1xC
5cnpB X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae. (see paper)
32% identity, 72% coverage: 21:145/173 of query aligns to 17:142/171 of 5cnpB
3wr7A Crystal structure of spermidine acetyltransferase from escherichia coli (see paper)
27% identity, 72% coverage: 21:145/173 of query aligns to 16:140/170 of 3wr7A
6d72B Crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
29% identity, 72% coverage: 21:145/173 of query aligns to 21:145/176 of 6d72B
P0A948 [Ribosomal protein uS5]-alanine N-acetyltransferase; Acetylating enzyme for N-terminal of ribosomal protein S5; EC 2.3.1.267 from Escherichia coli (strain K12) (see paper)
29% identity, 69% coverage: 45:164/173 of query aligns to 59:184/194 of P0A948
Sites not aligning to the query:
6yzzA Arabidopsis thaliana naa50 in complex with accoa (see paper)
31% identity, 57% coverage: 60:158/173 of query aligns to 45:147/151 of 6yzzA
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
30% identity, 66% coverage: 52:166/173 of query aligns to 57:170/171 of 2i79A
Sites not aligning to the query:
6z00A Arabidopsis thaliana naa50 in complex with bisubstrate analogue coa- ac-mvnal (see paper)
31% identity, 57% coverage: 60:158/173 of query aligns to 50:152/156 of 6z00A
Sites not aligning to the query:
4r9mA Crystal structure of spermidine n-acetyltransferase from escherichia coli (see paper)
26% identity, 68% coverage: 29:145/173 of query aligns to 25:141/169 of 4r9mA
>PfGW456L13_3289 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3289
MPATEPVITLERFNESHIEGVAALYNDPAIARQTLQMPFQSTELWRSRLALDNERLVNVV
ALHQGTVIGNIGLEQFSRIRRSHAGSFGMGVAVAWQGKGVGSKLLATALDIADNWMNLQR
IELSVYADNEAAISLYRKFGFETEGLFRDYAVRDGVLVDTLSMARLRRTPKAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory