Comparing PfGW456L13_330 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_330 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
80% identity, 100% coverage: 1:453/454 of query aligns to 1:452/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
80% identity, 100% coverage: 2:453/454 of query aligns to 1:451/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
80% identity, 99% coverage: 2:452/454 of query aligns to 1:450/450 of 3mduA
4f0lB Crystal structure of amidohydrolase from brucella melitensis
50% identity, 99% coverage: 6:453/454 of query aligns to 7:448/449 of 4f0lB
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
24% identity, 85% coverage: 48:433/454 of query aligns to 58:426/452 of 8is4A
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
25% identity, 85% coverage: 43:427/454 of query aligns to 57:409/439 of 4dzhA
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
25% identity, 85% coverage: 48:434/454 of query aligns to 59:418/441 of 3lnpA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
23% identity, 88% coverage: 42:442/454 of query aligns to 49:420/436 of 4f0rA
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
23% identity, 91% coverage: 39:450/454 of query aligns to 41:419/420 of Q58936
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
23% identity, 88% coverage: 42:442/454 of query aligns to 49:420/434 of 4f0sA
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
23% identity, 86% coverage: 44:434/454 of query aligns to 54:413/435 of 4gbdA
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
23% identity, 86% coverage: 44:434/454 of query aligns to 54:413/437 of 4dykA
3lscA Crystal structure of the mutant e241q of atrazine chlorohydrolase trzn from arthrobacter aurescens tc1 complexed with zinc and atraton
24% identity, 85% coverage: 49:434/454 of query aligns to 56:435/453 of 3lscA
3lsbA Crystal structure of the mutant e241q of atrazine chlorohydrolase trzn from arthrobacter aurescens tc1 complexed with zinc and ametrin
24% identity, 85% coverage: 49:434/454 of query aligns to 56:435/453 of 3lsbA
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
22% identity, 85% coverage: 48:434/454 of query aligns to 58:436/474 of Q9EYU0
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
22% identity, 85% coverage: 48:434/454 of query aligns to 58:436/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
22% identity, 85% coverage: 48:434/454 of query aligns to 58:436/474 of P72156
5hmdA Crystal structure of triazine hydrolase variant (y215h/e241q) (see paper)
24% identity, 85% coverage: 49:434/454 of query aligns to 58:437/456 of 5hmdA
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
23% identity, 88% coverage: 37:436/454 of query aligns to 45:405/428 of 3hpaA
2i9uA Crystal structure of guanine deaminase from c. Acetobutylicum with bound guanine in the active site
21% identity, 84% coverage: 48:429/454 of query aligns to 57:418/419 of 2i9uA
>PfGW456L13_330 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_330
MSAFFAERALLPSGWANNVRLEVSADGVLTHIQADSNADGAERLSGPLLPGMPNLHSHAF
QRAMAGLAEVAGNPNDSFWTWRDLMYRLVGKISPEQLGVIARQLYIEMLKAGYTSVAEFH
YVHHDISGQPYADPAELALRISQAAGSAGIGLTLLPVLYSHSGFGGQTPNEGQRRFINST
ENYLKLQSRLQPLLAQQPAQALGLCFHSLRAVTPQQISEVLAASDKQCPVHIHIAEQQKE
VDDCLTWSGRRPLQWLYENVEVDQRWCLVHATHANPEEVTSMARSRAIAGLCLTTEANLG
DGIFPAVDFLAQGGRMGIGSDSHVSLSVVEELRWLEYGQRLRDQRRNRLYGADQPMVGRT
LFDAALDGGAQALGQPIGALEVGKRADWLVLDGNDPYLATANGDGILNRWLFAGGDRQVR
DVLVNGQWVVRDGRHADEEESNRAFTQVLRELLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory