Comparing PfGW456L13_3394 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
45% identity, 98% coverage: 6:390/391 of query aligns to 6:397/397 of 8oqlC
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
45% identity, 98% coverage: 6:390/391 of query aligns to 7:401/401 of 8opyD
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
45% identity, 98% coverage: 6:390/391 of query aligns to 6:398/398 of 8oqoC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
45% identity, 98% coverage: 6:390/391 of query aligns to 7:399/399 of 8oqmD
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
44% identity, 99% coverage: 2:390/391 of query aligns to 2:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
44% identity, 99% coverage: 2:390/391 of query aligns to 2:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
44% identity, 99% coverage: 2:390/391 of query aligns to 2:402/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
44% identity, 99% coverage: 2:390/391 of query aligns to 2:402/402 of 4b3iC
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
44% identity, 99% coverage: 2:390/391 of query aligns to 3:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 99% coverage: 2:390/391 of query aligns to 3:403/403 of O53871
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
45% identity, 98% coverage: 6:390/391 of query aligns to 6:399/399 of 8opuC
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
44% identity, 98% coverage: 6:390/391 of query aligns to 6:398/398 of 8opxC
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
41% identity, 99% coverage: 1:389/391 of query aligns to 1:391/392 of P45359
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
41% identity, 99% coverage: 1:389/391 of query aligns to 1:391/392 of 4xl4A
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
41% identity, 100% coverage: 1:390/391 of query aligns to 1:392/393 of 6bn2A
4ubvA Structure of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis with an partially acetylated cysteine in complex with acetyl-coa and coa (see paper)
45% identity, 99% coverage: 5:390/391 of query aligns to 5:391/391 of 4ubvA
I6XHI4 Steroid 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase FadA5; Beta-ketoacyl-CoA thiolase; EC 2.3.1.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
45% identity, 99% coverage: 5:390/391 of query aligns to 5:391/391 of I6XHI4
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
43% identity, 99% coverage: 4:389/391 of query aligns to 5:393/394 of 1wl4A
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
43% identity, 99% coverage: 4:389/391 of query aligns to 8:396/397 of Q9BWD1
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
42% identity, 99% coverage: 1:389/391 of query aligns to 1:392/393 of P14611
>PfGW456L13_3394 3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)
MKDIVIVDAVRTPIGKFRGSLSGVRADHLGSLVISRLLERVDVSPTLVDDVIFGNVTQIG
EQSANIARTALLGAGWPVTVAGLTIDRKCGSGEVAVHMAVGAIAAGAADIVVAGGAENMS
RVPMGSNREIHGAAFGWMAAQRYELTSQGEAAERMADKWALSRDALDDFAFASHQRAAAA
CDAGYFDNETIPVVVEELREKELSEPAGVLRHDETIRRDTSREKLSTLKTSFRPDTGRIT
AGNSSQISDGAAALLLMSADTAKKLGLKARARVVAFTTVGSDPTLMLTGPIAATQKVLAK
AGLSINDIDLFEVNEAFASVPLAWMQETGVPHSKLNVNGGAIALGHPLGASGARLMTTML
NELERRGGRYGLQAICCAGGMGTATIIERLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory