SitesBLAST
Comparing PfGW456L13_3401 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3401 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5jy1A Crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 bound to NAD
71% identity, 100% coverage: 1:266/266 of query aligns to 1:266/266 of 5jy1A
- active site: G17 (= G17), S143 (= S143), H153 (= H153), Y156 (= Y156), K160 (= K160), P201 (= P201)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), G17 (= G17), I18 (= I18), E37 (= E37), I38 (≠ L38), T62 (= T62), D63 (= D63), V64 (= V64), N90 (= N90), A91 (= A91), F92 (= F92), V93 (≠ A93), S143 (= S143), Y156 (= Y156), K160 (= K160), P186 (= P186), T187 (= T187), A188 (= A188), A191 (= A191)
7wbcA Hydroxysteroid dehydrogenase wild-type complexed with NAD+ and (4s)-2- 2-methyl-2,4-pentanediol
38% identity, 92% coverage: 4:248/266 of query aligns to 3:245/250 of 7wbcA
- binding calcium ion: Y115 (≠ W117), P116 (≠ A118), H119 (≠ W121)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ E37), V37 (≠ L38), A61 (≠ T62), D62 (= D63), I63 (≠ V64), N89 (= N90), F138 (= F141), S140 (= S143), Y153 (= Y156), K157 (= K160), P183 (= P186), F184 (≠ T187), A185 (= A188), T187 (≠ G190), G189 (≠ T192), V190 (≠ F193)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 92% coverage: 3:248/266 of query aligns to 2:244/248 of 6ixmC
- active site: G16 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ G16), G16 (= G17), I17 (= I18), D36 (≠ E37), I37 (≠ L38), A61 (≠ T62), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), M140 (≠ F141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ T187), Y187 (≠ A188), I188 (≠ M189), L192 (≠ F193)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 94% coverage: 1:251/266 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (≠ T115), S139 (= S143), Q149 (≠ H153), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ N97), K98 (≠ E102), S139 (= S143), N146 (≠ A150), V147 (≠ W151), Q149 (≠ H153), Y152 (= Y156), F184 (≠ A191), M189 (≠ L196), K200 (≠ M206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ G16), G18 (= G17), I19 (= I18), D38 (≠ E37), F39 (≠ L38), V59 (≠ T62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (≠ A93), I90 (≠ P94), T137 (≠ F141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ A191), T185 (= T192), T187 (≠ H194), M189 (≠ L196)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
39% identity, 92% coverage: 3:248/266 of query aligns to 2:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ E37), L37 (= L38), C61 (≠ T62), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), T140 (≠ F141), S142 (= S143), Y155 (= Y156), K159 (= K160), A186 (≠ T187), V187 (≠ A188)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 93% coverage: 4:251/266 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (≠ G16), G19 (= G17), I20 (= I18), D39 (≠ E37), R40 (≠ L38), C63 (≠ T62), I65 (≠ V64), N91 (= N90), G93 (≠ A93), I94 (≠ P94), V114 (≠ S114), Y155 (= Y156), K159 (= K160), I188 (≠ M189), T190 (≠ A191), T193 (≠ H194)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
35% identity, 92% coverage: 4:249/266 of query aligns to 5:251/254 of 4fn4A
- active site: G18 (= G17), S144 (= S143), Y157 (= Y156), K161 (= K160), S202 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ G16), G18 (= G17), I19 (= I18), E38 (= E37), L39 (= L38), R43 (≠ S42), A63 (≠ T62), D64 (= D63), V65 (= V64), N91 (= N90), G93 (≠ F92), I94 (≠ A93), T142 (≠ F141), S144 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), V190 (≠ M189), T192 (= T192), N193 (≠ F193), I194 (≠ H194)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 91% coverage: 9:251/266 of query aligns to 4:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S143), Q148 (≠ H153), Y151 (= Y156), K155 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ G15), R11 (≠ G16), I13 (= I18), N31 (≠ A36), Y32 (≠ E37), A33 (≠ L38), G34 (vs. gap), S35 (≠ D39), A58 (≠ T62), N59 (≠ D63), V60 (= V64), N86 (= N90), A87 (= A91), T109 (≠ S114), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G190)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
36% identity, 92% coverage: 6:249/266 of query aligns to 2:253/256 of 1gegE
- active site: G13 (= G17), S139 (= S143), Y152 (= Y156), K156 (= K160), V197 (≠ A197)
- binding alpha-D-glucopyranose: R63 (≠ K67), D64 (≠ T68), F67 (≠ E71), E123 (≠ P128)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), Q12 (≠ G16), I14 (= I18), D33 (≠ E37), Y34 (≠ L38), V58 (≠ T62), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), I109 (≠ S114), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (vs. gap), T187 (= T187), M189 (= M189)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 91% coverage: 9:251/266 of query aligns to 7:246/246 of 3osuA
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
36% identity, 92% coverage: 6:249/266 of query aligns to 2:253/256 of Q48436
- 6:33 (vs. 10:37, 57% identical) binding
- D59 (= D63) binding
- K156 (= K160) binding
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
35% identity, 94% coverage: 2:251/266 of query aligns to 1:253/256 of 7do7A
- active site: G16 (= G17), S146 (= S143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ G16), G16 (= G17), I17 (= I18), S37 (≠ L38), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (≠ F92), I96 (≠ A93), V144 (≠ F141), S145 (≠ Y142), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (≠ T187), I192 (≠ M189), T194 (≠ A191), I196 (≠ F193)
- binding beta-L-rhamnopyranose: F99 (≠ P96), S146 (= S143), S148 (≠ D145), Q156 (≠ H153), Y159 (= Y156), N197 (≠ H194), D235 (≠ E233), M236 (= M234), R238 (= R236)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
35% identity, 94% coverage: 2:251/266 of query aligns to 1:253/256 of 7b81A
- active site: G16 (= G17), S146 (= S143), Y159 (= Y156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S14 (≠ G15), R15 (≠ G16), I17 (= I18), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (≠ F92), I96 (≠ A93), T116 (≠ S114), V144 (≠ F141), S146 (= S143), Y159 (= Y156), K163 (= K160), P189 (= P186), G190 (≠ T187), I192 (≠ M189), T194 (≠ A191), I196 (≠ F193)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
37% identity, 92% coverage: 3:248/266 of query aligns to 2:244/248 of 4urfB
- active site: G16 (= G17), S142 (= S143), I152 (≠ H153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L213), R211 (≠ G214), R212 (= R215)
- binding bicarbonate ion: I92 (vs. gap), G94 (vs. gap), R109 (≠ Q110), R179 (= R180), S228 (= S232)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (= G15), N15 (≠ G16), G16 (= G17), I17 (= I18), D36 (≠ E37), I37 (≠ L38), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (vs. gap), I140 (≠ F141), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ T187), I188 (≠ M189), T190 (≠ A191)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
37% identity, 92% coverage: 3:248/266 of query aligns to 2:244/248 of 4urfA
- active site: G16 (= G17), S142 (= S143), I152 (≠ H153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (vs. gap), S93 (vs. gap), G94 (vs. gap), E95 (vs. gap), T97 (≠ A93), E101 (= E102), T103 (= T104), Q106 (≠ M107), R109 (≠ Q110), S175 (≠ R176), G177 (≠ N178)
- binding magnesium ion: S237 (≠ E241), Y238 (≠ T242)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (= G15), N15 (≠ G16), G16 (= G17), I17 (= I18), D36 (≠ E37), I37 (≠ L38), W41 (≠ S42), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (vs. gap), I140 (≠ F141), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ M189), T190 (≠ A191)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
37% identity, 92% coverage: 3:248/266 of query aligns to 2:244/248 of 4ureB
- active site: G16 (= G17), S142 (= S143), I152 (≠ H153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ G16), G16 (= G17), I17 (= I18), N89 (= N90), G91 (vs. gap), Y155 (= Y156), P185 (= P186), A186 (≠ T187)
7x5jC Acp-dependent oxoacyl reductase
34% identity, 93% coverage: 4:251/266 of query aligns to 2:253/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), G15 (= G17), L16 (≠ I18), N36 (≠ E37), R37 (≠ L38), N38 (≠ D39), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), A91 (≠ F92), V114 (≠ S114), I141 (≠ F141), Y156 (= Y156), K160 (= K160), L186 (≠ P186), G187 (≠ T187), V188 (≠ A188), R194 (vs. gap), S197 (≠ A191), S198 (≠ T192)
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
38% identity, 92% coverage: 6:249/266 of query aligns to 1:252/255 of 3wyeA
- active site: G12 (= G17), S138 (= S143), Y151 (= Y156), K155 (= K160), L196 (≠ F193)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), Q11 (≠ G16), G12 (= G17), I13 (= I18), D32 (≠ E37), Y33 (≠ L38), V57 (≠ T62), D58 (= D63), V59 (= V64), N85 (= N90), A86 (= A91), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (≠ T187), V184 (≠ M189), T186 (vs. gap), M188 (vs. gap), W189 (vs. gap)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
35% identity, 94% coverage: 2:251/266 of query aligns to 1:244/247 of 7do6A
- active site: G16 (= G17), S146 (= S143), Y159 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ G16), G16 (= G17), I17 (= I18), H36 (≠ E37), S37 (≠ L38), G42 (= G43), D66 (= D63), A67 (≠ V64), N93 (= N90), A94 (= A91), G95 (≠ F92), I96 (≠ A93), T116 (≠ S114), S146 (= S143), Y159 (= Y156), K163 (= K160), I192 (≠ M189)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
36% identity, 90% coverage: 10:249/266 of query aligns to 51:289/292 of 5jydB
- active site: G58 (= G17), S184 (= S143), L194 (≠ H153), Y197 (= Y156), K201 (= K160), P242 (= P201)
- binding magnesium ion: D56 (≠ G15), S57 (≠ G16), E82 (≠ A41)
- binding nicotinamide-adenine-dinucleotide: G54 (= G13), D56 (≠ G15), S57 (≠ G16), G58 (= G17), I59 (= I18), L79 (= L38), E82 (≠ A41), D106 (= D63), I107 (≠ V64), N133 (= N90), A134 (= A91), A135 (≠ F92), T182 (≠ F141), S184 (= S143), Y197 (= Y156), K201 (= K160), P227 (= P186), G228 (≠ T187), P229 (≠ A188), Y230 (≠ M189), T232 (≠ A191), L234 (≠ F193), Q235 (≠ H194)
Query Sequence
>PfGW456L13_3401 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3401
MALLNEQVALITGAGGGIGRGIALNFAKEGAAVVVAELDVASGEAVVAELKALGGQAVFI
KTDVCSKTDIEAAVQLAIDQFGGLDILVNNAFAPTPNVLLEEKTDAMLEQTLGSTVWAAW
WAMKAALPHMKARGGGKIINFYSIDIEIGAWLHGDYNTAKSAIVGLTRSAASEWGRFNIR
TNAIAPTAMGATFHKLAAENPGFAEMSASMRPLGRCGEPEADIGPVVVFLASEMSRFITG
ETIHVDGGLHLPGYNSRPKGIPVREY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory