Comparing PfGW456L13_3405 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
30% identity, 93% coverage: 17:326/332 of query aligns to 16:302/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
30% identity, 93% coverage: 17:326/332 of query aligns to 15:301/303 of 8skyB
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 61% coverage: 122:325/332 of query aligns to 73:278/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 61% coverage: 122:325/332 of query aligns to 73:278/290 of 8gsrA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
37% identity, 49% coverage: 163:325/332 of query aligns to 116:274/277 of 6iymA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
36% identity, 61% coverage: 125:325/332 of query aligns to 70:260/265 of 3r6oA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
31% identity, 59% coverage: 124:319/332 of query aligns to 74:269/279 of 6v77B
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
32% identity, 56% coverage: 141:325/332 of query aligns to 76:247/252 of 3qdfA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
32% identity, 51% coverage: 161:328/332 of query aligns to 56:216/216 of 6sbiA
Sites not aligning to the query:
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
31% identity, 59% coverage: 131:325/332 of query aligns to 73:266/269 of 4dbhA
Sites not aligning to the query:
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 51% coverage: 157:325/332 of query aligns to 69:230/233 of 6j5yA
Sites not aligning to the query:
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
31% identity, 50% coverage: 161:327/332 of query aligns to 57:216/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
31% identity, 50% coverage: 161:327/332 of query aligns to 62:221/224 of Q6P587
Sites not aligning to the query:
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 53% coverage: 150:325/332 of query aligns to 101:276/280 of 6j5xB
Sites not aligning to the query:
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
28% identity, 53% coverage: 150:325/332 of query aligns to 101:276/280 of 6j5xA
1gttA Crystal structure of hpce (see paper)
27% identity, 53% coverage: 118:292/332 of query aligns to 221:387/421 of 1gttA
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
36% identity, 42% coverage: 189:327/332 of query aligns to 152:288/291 of 3bqbX
Sites not aligning to the query:
2q1cX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with calcium and 2- oxobutyrate (see paper)
36% identity, 42% coverage: 189:327/332 of query aligns to 152:288/291 of 2q1cX
Sites not aligning to the query:
2q1aX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2-oxobutyrate (see paper)
36% identity, 42% coverage: 189:327/332 of query aligns to 152:288/291 of 2q1aX
Sites not aligning to the query:
Q97UA0 2-dehydro-3-deoxy-D-arabinonate dehydratase; 2-keto-3-deoxy-D-arabinonate dehydratase; KdaD; EC 4.2.1.141 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
36% identity, 42% coverage: 189:327/332 of query aligns to 157:293/298 of Q97UA0
Sites not aligning to the query:
>PfGW456L13_3405 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3405
MRLVTYSDAEGFDRAGALLNQDQQVLDLQIAYRLLESRETPALSSILSLVEGGEPALELA
RSLVAKAPSAAVLERASVKLRAPIQPPPQMRDCSCFELHLRQSFAAARRARALRTEDPEA
TLKAMNTRADDRVIETFNKQPIYYKGNRFAVIGIDDEFQWPSFSRAMDFELEFGCYIGKR
GKDISRETARSHIVGYTIFNDMSARDAQALEMPGMLGPAKSKDFDTANIMGPCLVTADEL
GDPYDLNMVARVNGEEWGRGNTRDMRWSFEDVIAHVSRSETLYPGEFLGSGTVGNGCGLE
QLRYLKPGDVVELEIDGIGVLRTQVGKAPSKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory