Comparing PfGW456L13_3477 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3477 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3dbnA Crystal structure of the streptoccocus suis serotype2 d- mannonate dehydratase in complex with its substrate (see paper)
47% identity, 95% coverage: 1:342/361 of query aligns to 3:331/349 of 3dbnA
3bdkA Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
47% identity, 95% coverage: 1:342/361 of query aligns to 3:331/349 of 3bdkA
4eacC Crystal structure of mannonate dehydratase from escherichia coli strain k12 (see paper)
36% identity, 94% coverage: 1:339/361 of query aligns to 3:385/396 of 4eacC
4eayA Crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate (see paper)
36% identity, 94% coverage: 1:339/361 of query aligns to 3:385/395 of 4eayA
>PfGW456L13_3477 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3477
MKMIFRWHGPKDPINLQYINQIPGLYGIVSSLYDTPLGEVWPVDRITSLRDAAAAYGLKM
DVVDSFRVHEDIKLGKPNREALIPQYIETLKNLAASGIKIVCYNFMPVFDWTRTQMEYQL
PDGSNTLSFEASLVDRLDVSKGVIPLPGIGTKYPAEKLQALLEEYKDVSTEQMWKNLEWF
LGKLVPVAEQLGLKLALHADDPPRSVFGLPRIIKNIEDHRRVLSIIDSPANGLTLCSGTI
GSDLNNDVPSFINEFAARQRVHYVHLRNVKVFDNGDFYESAHPTQCGSLDMAEILKALHD
ANFTGYARPDHGRMIWGETGVPGYGLYDRALGTMYLQGLWEGIGKEKTKAVLQKQGPAAV
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory