Comparing PfGW456L13_3595 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3595 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5a1sD Crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. (see paper)
31% identity, 95% coverage: 25:448/448 of query aligns to 3:432/434 of 5a1sD
5x9rA Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
30% identity, 92% coverage: 34:443/448 of query aligns to 6:412/416 of 5x9rA
5xarD Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
28% identity, 96% coverage: 21:448/448 of query aligns to 1:411/411 of 5xarD
5xasB Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
28% identity, 95% coverage: 25:448/448 of query aligns to 2:407/407 of 5xasB
>PfGW456L13_3595 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3595
MNKPYEQSLKIETASDGGFVQRLRSLCAYEIGVIPLPIFLGIAVIVYLSAHLGFLPKNMI
GGLAVIMTMGVFFGQMGSRLPILKEIGGGAILCLMLPSILVFYGFFGPATIDATKMLMKE
ANFLYFVIASLVVGSILGMSRFILVQGMLRMFIPLLVGTLAAVASGLIVGKLVGYSFHHT
FFFIIVPIIGGGIGEGILPLSLAYSAILGGTPDIYVAQLAPAAVVGNIVAIICAGYLARL
ALKRPTINGEGSLIRAKDENDQFLVKEDTGTIVDFRVMGAGVLVICAFFVLGGLLEKVVG
IPGPVMMILAAVLFKYLRVLPEKLEKGANSFYKLVSSAFIWPVMIGLGMLYVPLDSVVKV
FSVGYVLVCVSVVVSMTVAGFFIGNLMKMYPIESAIVTCCHSGLGGTGDVAILSASNRMS
LMPFAQISTRIGGASTVILATILLRLFV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory