Comparing PfGW456L13_3631 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3631 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7yleA Rndmpx in complex with dmsp (see paper)
24% identity, 91% coverage: 29:314/316 of query aligns to 5:296/299 of 7yleA
1r9qA Structure analysis of prox in complex with proline betaine (see paper)
24% identity, 77% coverage: 70:311/316 of query aligns to 51:308/309 of 1r9qA
Sites not aligning to the query:
P0AFM2 Glycine betaine/proline betaine-binding periplasmic protein; GBBP from Escherichia coli (strain K12) (see 2 papers)
24% identity, 77% coverage: 70:311/316 of query aligns to 72:329/330 of P0AFM2
Sites not aligning to the query:
4xz6A Tmox in complex with tmao (see paper)
21% identity, 86% coverage: 35:305/316 of query aligns to 12:290/291 of 4xz6A
Q5LT66 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
21% identity, 86% coverage: 35:305/316 of query aligns to 54:332/333 of Q5LT66
Sites not aligning to the query:
>PfGW456L13_3631 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3631
LLTSLLTLGLLVGSASSQASGWCESGKSVKFAGLNWESGMLLTDIMMIVLKDGYGCTTDQ
LVGNTIILETALAGNDIQVFGEEWMERSEVWKKAVAAGKVVGVGAPIIGATQGWYVPRYV
VEGDAKRNRPAQAPDLRTVADLSKYASVFRDSEEPSKGRFYNCPAGWICEQDNTEMLKEY
GLENTFTNFRPGTGAALDAAVLSSYKRGEPVLFYYWSPTPLMGQIDAIRLEEKTGANKDV
ITMVGLSKAFHEQAPELVAVLEKVNIPIDLLNQNLARMTRERIESPKLARMFLKEHPEIW
HAWVDEAAAKKIEASL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory