Comparing PfGW456L13_3703 Arginine/ornithine ABC transporter, ATP-binding protein AotP to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
69% identity, 99% coverage: 3:254/254 of query aligns to 6:258/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
69% identity, 99% coverage: 3:254/254 of query aligns to 2:254/258 of 1b0uA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
52% identity, 98% coverage: 6:253/254 of query aligns to 4:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
50% identity, 97% coverage: 4:250/254 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
50% identity, 97% coverage: 4:250/254 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
50% identity, 97% coverage: 4:250/254 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
50% identity, 97% coverage: 4:250/254 of query aligns to 4:239/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
51% identity, 97% coverage: 4:249/254 of query aligns to 3:236/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 96% coverage: 9:253/254 of query aligns to 11:245/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 96% coverage: 9:253/254 of query aligns to 12:246/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 96% coverage: 9:253/254 of query aligns to 12:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 96% coverage: 9:253/254 of query aligns to 12:246/344 of 3tuiC
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
39% identity, 83% coverage: 17:227/254 of query aligns to 21:220/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
37% identity, 88% coverage: 4:227/254 of query aligns to 4:216/223 of 2pclA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 81% coverage: 4:208/254 of query aligns to 5:203/648 of P75831
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 96% coverage: 8:252/254 of query aligns to 31:266/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 96% coverage: 8:252/254 of query aligns to 31:266/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
33% identity, 94% coverage: 8:246/254 of query aligns to 31:260/260 of 7ahdC
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
38% identity, 85% coverage: 4:219/254 of query aligns to 3:213/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 85% coverage: 4:219/254 of query aligns to 6:216/233 of P75957
>PfGW456L13_3703 Arginine/ornithine ABC transporter, ATP-binding protein AotP
MYKLEVQDLHKSYGAHQVLNGVSLQAQAGDVISIIGSSGSGKSTFLRCINLLEQPNAGNI
VLNGEPLKLVANKLGGLKAAEPRQLQRMRSQLSMVFQHFNLWSHMSALENVMEAPVHVLG
LGKKEAREKAEHYLNKVGVAHRMNAWPAHMSGGEQQRVAIARALAMEPQVMLFDEPTSAL
DPELVGEVLKVMQDLAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEERGDPREVLVNP
QSERLRQFLAGSLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory