Comparing PfGW456L13_3720 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
2blfB Sulfite dehydrogenase from starkeya novella (see paper)
53% identity, 38% coverage: 25:105/212 of query aligns to 1:81/81 of 2blfB
P00099 Cytochrome c-551; Cytochrome C8; Cytochrome c551 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 4 papers)
45% identity, 46% coverage: 116:212/212 of query aligns to 9:103/104 of P00099
Sites not aligning to the query:
351cA Structure of cytochrome c551 from p. Aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms (see paper)
48% identity, 38% coverage: 132:212/212 of query aligns to 2:81/82 of 351cA
5xecA Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
52% identity, 37% coverage: 132:210/212 of query aligns to 2:79/82 of 5xecA
2exvA Crystal structure of the f7a mutant of the cytochrome c551 from pseudomonas aeruginosa (see paper)
48% identity, 38% coverage: 132:212/212 of query aligns to 2:81/82 of 2exvA
1a56A Primary sequence and solution conformation of ferricytochromE C-552 from nitrosomonas europaea, nmr, mean structure refined with explicit hydrogen bond constraints (see paper)
48% identity, 35% coverage: 136:210/212 of query aligns to 4:78/81 of 1a56A
1corA Investigation of the solution conformation of cytochromE C-551 from pseudomonas stutzeri (see paper)
44% identity, 38% coverage: 132:212/212 of query aligns to 2:81/82 of 1corA
6kq1A Crystal structure of cytochrome c551 from pseudomonas sp. Strain mt-1.
43% identity, 37% coverage: 132:210/212 of query aligns to 2:79/82 of 6kq1A
2d0sA Crystal structure of the cytochrome c552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus (see paper)
40% identity, 35% coverage: 136:210/212 of query aligns to 4:76/79 of 2d0sA
5xecC Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
44% identity, 36% coverage: 136:212/212 of query aligns to 4:79/80 of 5xecC
5aurA Hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region (see paper)
47% identity, 35% coverage: 136:210/212 of query aligns to 4:80/83 of 5aurA
1cchA The solution conformation of cytochromE C-551 from p.Stutzeri zobell determined by nmr+ (see paper)
42% identity, 37% coverage: 132:210/212 of query aligns to 2:79/82 of 1cchA
4xxlA Crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1 (see paper)
32% identity, 37% coverage: 133:210/212 of query aligns to 7:88/92 of 4xxlA
>PfGW456L13_3720 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3720
MKLVKCMTALLCAAQVCLATLAGAAPLSITLPPETAAFKPSTMPGYALAQQKCSVCHSAD
YINFQPPGMSLAQWTAEAGKMQHVYGAPISDRDVSVIGAYLAVTYGSAKANDADVLAASS
APVVAGAGAKVDAKVLLQNNACLSCHATDHKVVGPAYRDVAAKYAKDPQAMDRLMSSIQN
GGSGKWGDVPMPPFTQLSPDDLKSLATFILQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory