SitesBLAST
Comparing PfGW456L13_3745 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
49% identity, 99% coverage: 6:426/426 of query aligns to 2:421/423 of 5g4jA
- active site: S14 (= S18), Y130 (= Y134), D201 (= D206), D234 (= D239), Q237 (= Q242), K264 (= K269), T294 (= T299), K395 (= K400)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (= Y48), R73 (= R77), G103 (= G107), S104 (= S108), Y130 (= Y134), H131 (= H135), D234 (= D239), V236 (= V241), Q237 (= Q242), K264 (= K269), T294 (= T299), R397 (= R402)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
49% identity, 99% coverage: 6:426/426 of query aligns to 2:421/423 of 5g4iA
- active site: S14 (= S18), Y130 (= Y134), D201 (= D206), D234 (= D239), Q237 (= Q242), K264 (= K269), T294 (= T299), K395 (= K400)
- binding pyridoxal-5'-phosphate: G103 (= G107), S104 (= S108), H131 (= H135), D234 (= D239), V236 (= V241), Q237 (= Q242), K264 (= K269)
- binding phosphate ion: Y44 (= Y48), R397 (= R402)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
42% identity, 94% coverage: 26:426/426 of query aligns to 1:397/404 of 6torB
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
32% identity, 95% coverage: 23:426/426 of query aligns to 29:446/448 of 6io1B
- active site: Y151 (= Y134), D257 (= D239), K286 (= K269)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ T106), G118 (= G107), A119 (≠ S108), N122 (= N111), Y151 (= Y134), H152 (= H135), D257 (= D239), V259 (= V241), I260 (≠ Q242), K286 (= K269)
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
33% identity, 95% coverage: 20:425/426 of query aligns to 26:450/453 of 6s54A
- active site: Y152 (= Y134), D258 (= D239), K287 (= K269)
- binding pyridoxal-5'-phosphate: G119 (= G107), S120 (= S108), Y152 (= Y134), H153 (= H135), G154 (= G136), E225 (≠ D206), D258 (= D239), V260 (= V241), I261 (≠ Q242), K287 (= K269)
Sites not aligning to the query:
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1zobA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding calcium ion: L76 (≠ I74), S78 (≠ T76), V303 (≠ G301), S304 (≠ G302), D305 (≠ S303)
- binding pyridoxal-5'-phosphate: T108 (= T106), A110 (≠ S108), N113 (= N111), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269)
Sites not aligning to the query:
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1zc9A
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G107), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269)
Sites not aligning to the query:
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1m0qA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (vs. gap), T108 (= T106), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), S213 (≠ N211), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
Sites not aligning to the query:
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1m0pA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (vs. gap), T108 (= T106), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), S213 (≠ N211), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
Sites not aligning to the query:
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1m0oA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (vs. gap), G109 (= G107), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
Sites not aligning to the query:
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1m0nA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (vs. gap), M51 (vs. gap), A110 (≠ S108), N113 (= N111), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), S213 (≠ N211), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
Sites not aligning to the query:
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1d7vA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding potassium ion: H75 (vs. gap), L76 (≠ I74), F77 (≠ H75), S78 (≠ T76), T301 (= T299), H302 (≠ F300), V303 (≠ G301), S304 (≠ G302), D305 (≠ S303)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), S213 (≠ N211), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
Sites not aligning to the query:
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1d7uA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding potassium ion: H75 (vs. gap), L76 (≠ I74), F77 (≠ H75), S78 (≠ T76), T301 (= T299), H302 (≠ F300), V303 (≠ G301), S304 (≠ G302), D305 (≠ S303)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G107), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
Sites not aligning to the query:
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1d7sA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (vs. gap), G109 (= G107), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
- binding potassium ion: H75 (vs. gap), L76 (≠ I74), F77 (≠ H75), S78 (≠ T76), T301 (= T299), H302 (≠ F300), V303 (≠ G301), S304 (≠ G302), D305 (≠ S303)
Sites not aligning to the query:
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1d7rA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G107), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), S213 (≠ N211), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269), R404 (≠ K400)
- binding potassium ion: H75 (vs. gap), L76 (≠ I74), F77 (≠ H75), S78 (≠ T76), T301 (= T299), H302 (≠ F300), V303 (≠ G301), S304 (≠ G302), D305 (≠ S303)
Sites not aligning to the query:
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
31% identity, 94% coverage: 24:423/426 of query aligns to 23:427/431 of 1dgdA
- active site: W136 (≠ Y134), E208 (≠ D206), D241 (= D239), Q244 (= Q242), K270 (= K269), T301 (= T299), R404 (≠ K400)
- binding pyridoxal-5'-phosphate: T108 (= T106), G109 (= G107), A110 (≠ S108), W136 (≠ Y134), H137 (= H135), E208 (≠ D206), D241 (= D239), A243 (≠ V241), Q244 (= Q242), K270 (= K269)
Sites not aligning to the query:
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
32% identity, 96% coverage: 14:424/426 of query aligns to 16:446/449 of 5lh9D
- active site: Y148 (= Y134), D255 (= D239), K284 (= K269), T321 (= T299)
- binding pyridoxal-5'-phosphate: G115 (= G107), S116 (= S108), Y148 (= Y134), H149 (= H135), G150 (= G136), E222 (≠ D206), D255 (= D239), V257 (= V241), K284 (= K269)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
32% identity, 96% coverage: 14:424/426 of query aligns to 14:444/447 of 5lhaA
- active site: Y146 (= Y134), D253 (= D239), K282 (= K269), T319 (= T299)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G107), S114 (= S108), Y146 (= Y134), H147 (= H135), G148 (= G136), E220 (≠ D206), D253 (= D239), K282 (= K269), Y318 (≠ N298), T319 (= T299)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
32% identity, 92% coverage: 33:426/426 of query aligns to 34:432/439 of 5wyaA
- active site: Y140 (= Y134), E215 (≠ D206), D248 (= D239), N251 (≠ Q242), K278 (= K269), T307 (≠ N298), R406 (≠ K400)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V51), Y82 (≠ L79), S112 (≠ T106), G113 (= G107), S114 (= S108), Y140 (= Y134), H141 (= H135), E215 (≠ D206), D248 (= D239), V250 (= V241), N251 (≠ Q242), K278 (= K269), F306 (= F297), T307 (≠ N298), R406 (≠ K400)
Sites not aligning to the query:
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
32% identity, 92% coverage: 33:426/426 of query aligns to 43:441/448 of 4ysnC
- active site: Y149 (= Y134), E224 (≠ D206), D257 (= D239), N260 (≠ Q242), K287 (= K269), T316 (≠ N298), R415 (≠ K400)
- binding pyridoxal-5'-phosphate: S121 (≠ T106), G122 (= G107), S123 (= S108), Y149 (= Y134), H150 (= H135), E224 (≠ D206), D257 (= D239), V259 (= V241), K287 (= K269), F315 (= F297), T316 (≠ N298)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_3745 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3745
MPEDTLLQRRHRVLGSASPLFYDKPLHLVRGEGVWLFDVDGRRYLDVYNNVPCVGHCNPH
VTEAMHRQATTLNIHTRYLDEQVVCYAERLTATFAAPLDTVMFTCTGSEANELALRLARF
ASGGTGIIVSDYNYHGNSASLAEVTTALPSPEPFAAHARAVPIPCLYHAPAGTTEAQLAE
QYAANIAAAIASMQAQGIRPAALLIDTLFANEGLPRVPASFVNKAAALIRAAGGLFIADE
VQSGFGRTGDHLWGHQAHGVVPDIVTLGKPMGNGYPLAGLITHKALVESFGRHAMYFNTF
GGSPVAAAVGMAVLDVIEEQQLLQNAQNVGAYVQQRLQVLAGKHSIIGDVRGKGLFFAME
LVRDHASKEPAGLEARKVVNDMRENGVLISKIGAGDNILKLRPPLVFSRDHADLFVDTLD
SALSAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory