SitesBLAST
Comparing PfGW456L13_3754 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3754 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
34% identity, 87% coverage: 23:392/427 of query aligns to 27:403/471 of O85673
- M43 (≠ L39) mutation to K: Prevents anthranilate degradation.
- D217 (= D211) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
29% identity, 98% coverage: 11:427/427 of query aligns to 3:425/433 of 2xshA
- active site: H106 (= H112), D204 (= D211), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding 2,6-dichlorobiphenyl: F201 (vs. gap), M205 (≠ G212), H207 (vs. gap), Q296 (≠ F304), H297 (≠ N305), L307 (vs. gap), F358 (≠ G364)
- binding fe (ii) ion: Q200 (≠ N208), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
29% identity, 98% coverage: 11:427/427 of query aligns to 3:425/433 of 2yflA
- active site: H106 (= H112), D204 (= D211), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding 2-chlorodibenzofuran: Q200 (≠ N208), D204 (= D211), M205 (≠ G212), H207 (vs. gap), S257 (vs. gap), H297 (≠ N305), L307 (vs. gap), F352 (= F357)
- binding fe (ii) ion: Q200 (≠ N208), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
29% identity, 98% coverage: 11:427/427 of query aligns to 3:425/433 of 2yfjA
- active site: H106 (= H112), D204 (= D211), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding dibenzofuran: Q200 (≠ N208), F201 (vs. gap), D204 (= D211), M205 (≠ G212), H207 (vs. gap), A208 (vs. gap), H297 (≠ N305), L307 (vs. gap), F358 (≠ G364)
- binding fe (ii) ion: Q200 (≠ N208), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
29% identity, 98% coverage: 11:427/427 of query aligns to 3:425/433 of 5aeuA
- active site: H106 (= H112), D204 (= D211), H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding fe (ii) ion: H207 (vs. gap), H213 (= H214), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), M88 (≠ A94), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
29% identity, 98% coverage: 11:427/427 of query aligns to 3:424/432 of 2xrxA
- active site: H106 (= H112), D203 (= D211), H206 (vs. gap), H212 (= H214), D361 (= D368)
- binding biphenyl: Q199 (≠ N208), F200 (vs. gap), D203 (= D211), H206 (vs. gap), H296 (≠ N305), L306 (≠ S315), F309 (= F318), F357 (≠ G364)
- binding fe (ii) ion: Q199 (≠ N208), H206 (vs. gap), H212 (= H214), D361 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
7c8zA Crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) (see paper)
29% identity, 95% coverage: 23:427/427 of query aligns to 16:383/383 of 7c8zA
- active site: H106 (= H112), D213 (= D211), H216 (= H214), H221 (= H219), D330 (= D368)
- binding fe (iii) ion: H216 (= H214), H221 (= H219), D330 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), C103 (= C109), H106 (= H112), W108 (= W114)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
29% identity, 95% coverage: 23:426/427 of query aligns to 16:412/425 of 1uliC
- active site: H105 (= H112), D205 (= D211), H208 (= H214), H214 (≠ F222), D350 (= D368)
- binding fe (ii) ion: H208 (= H214), H214 (≠ F222), D350 (= D368)
- binding fe2/s2 (inorganic) cluster: C82 (= C89), H84 (= H91), R85 (= R92), C102 (= C109), Y104 (= Y111), H105 (= H112), W107 (= W114)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
28% identity, 95% coverage: 23:426/427 of query aligns to 16:414/425 of 1uljA
- active site: H105 (= H112), D205 (= D211), H208 (= H214), H214 (≠ E229), D352 (= D368)
- binding biphenyl: Q201 (≠ N208), F202 (vs. gap), D205 (= D211), M206 (≠ G212), H208 (= H214), A209 (≠ S224), H214 (≠ E229), I252 (≠ E274), H287 (≠ N305), L297 (vs. gap), F342 (= F357)
- binding fe (ii) ion: Q201 (≠ N208), H208 (= H214), H214 (≠ E229), D352 (= D368)
- binding fe2/s2 (inorganic) cluster: C82 (= C89), H84 (= H91), R85 (= R92), M87 (≠ A94), C102 (= C109), Y104 (= Y111), H105 (= H112), W107 (= W114)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
27% identity, 95% coverage: 23:426/427 of query aligns to 16:423/424 of 3en1A
- active site: H105 (= H112), D205 (= D211), H208 (= H214), H214 (vs. gap), D360 (= D368)
- binding fe (ii) ion: Q201 (≠ N208), H208 (= H214), H214 (vs. gap), D360 (= D368)
- binding fe2/s2 (inorganic) cluster: C82 (= C89), H84 (= H91), R85 (= R92), C102 (= C109), Y104 (= Y111), H105 (= H112), W107 (= W114)
- binding toluene: Q201 (≠ N208), F202 (vs. gap), D205 (= D211), H208 (= H214), H295 (≠ N305)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
28% identity, 95% coverage: 23:426/427 of query aligns to 32:440/460 of Q53122
- C98 (= C89) binding
- H100 (= H91) binding
- C118 (= C109) binding
- H121 (= H112) binding
- 217:230 (vs. 208:219, 29% identical) binding
- H224 (= H214) binding
- H230 (= H219) binding
- D378 (= D368) binding
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
29% identity, 95% coverage: 24:427/427 of query aligns to 18:428/436 of 1wqlA
- active site: H106 (= H112), D208 (= D211), H211 (= H219), H217 (≠ S225), D365 (= D368)
- binding fe (ii) ion: H211 (= H219), H217 (≠ S225), D365 (= D368)
- binding fe2/s2 (inorganic) cluster: C83 (= C89), H85 (= H91), R86 (= R92), C103 (= C109), Y105 (= Y111), H106 (= H112), W108 (= W114)
- binding oxygen molecule: H211 (= H219), F355 (≠ H356)
4hm0A Naphthalene 1,2-dioxygenase bound to indole-3-acetate
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/447 of 4hm0A
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding 1h-indol-3-ylacetic acid: N201 (= N208), D205 (= D211), H208 (= H214), V209 (≠ F215), H213 (= H219), H295 (≠ L299), N297 (= N305)
1uuvA Naphthalene 1,2-dioxygenase with nitric oxide and indole bound in the active site. (see paper)
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/447 of 1uuvA
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding indole: N297 (= N305), L307 (vs. gap)
- binding nitric oxide: H208 (= H214), H213 (= H219)
1o7pA Naphthalene 1,2-dioxygenase, product complex (see paper)
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/447 of 1o7pA
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding (1r, 2s)-cis 1,2 dihydroxy-1,2-dihydronaphthalene: N201 (= N208), H208 (= H214), V209 (≠ F215), H213 (= H219), H295 (≠ L299)
1o7mA Naphthalene 1,2-dioxygenase, binary complex with dioxygen (see paper)
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/447 of 1o7mA
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding oxygen molecule: H208 (= H214), H213 (= H219)
1o7gA Naphthalene 1,2-dioxygenase with naphthalene bound in the active site. (see paper)
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/447 of 1o7gA
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding naphthalene: N201 (= N208), D205 (= D211), H208 (= H214), H295 (≠ L299), N297 (= N305)
1eg9A Naphthalene 1,2-dioxygenase with indole bound in the active site. (see paper)
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/447 of 1eg9A
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding indole: N201 (= N208), H208 (= H214), V209 (≠ F215), N297 (= N305), L307 (vs. gap)
4hm8A Naphthalene 1,2-dioxygenase bound to thioanisole
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/446 of 4hm8A
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding (methylsulfanyl)benzene: N201 (= N208), H295 (≠ L299)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
4hm7A Naphthalene 1,2-dioxygenase bound to styrene
30% identity, 94% coverage: 28:427/427 of query aligns to 20:426/446 of 4hm7A
- active site: H104 (= H112), D205 (= D211), H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe (iii) ion: H208 (= H214), H213 (= H219), D362 (= D368)
- binding fe2/s2 (inorganic) cluster: C81 (= C89), H83 (= H91), R84 (= R92), C101 (= C109), Y103 (= Y111), H104 (= H112), W106 (= W114)
- binding ethenylbenzene: N201 (= N208), H208 (= H214), H295 (≠ L299), N297 (= N305)
Query Sequence
>PfGW456L13_3754 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3754
MSTHEYQLIATSKSPEDLVQHDRVDVSLYNDPALFEAELDKIFYRTWVWVAHESEVRNSG
DFKTATIGRRPVIVVRDKKNNINVLENRCRHRGATVCEKHKGNATGFTCPYHSWSYGLDG
KLRALPYPDGYEGILEKSELPLTSLRVESYAGMVFASYNDEIEPLEDFLGGAKHWMDLFM
KQGAGYPIKTQGEHKFSFKGNWKIQLENTTDGYHFPIVHKSFMSSVDEETSEMLSFMTDE
QAVTHSLGNGHSVMVMVPEHVDLDHDDGTEQLQERFAHVTEELSKTLPADQVRRIVRSLH
GAGFNLNLFPNVAMSMSFFRVLRPVSVTETEIRHVALGMDGGPEIANRERMRIHEHFQGP
FGFGSPDDAEAWDRVQRGSYAGVDAPILVNRGLNREITAENGDKVSHATDEGGMRGAYDM
WKRMMSQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory