Comparing PfGW456L13_3770 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 96% coverage: 6:251/255 of query aligns to 16:261/265 of P07821
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 92% coverage: 1:235/255 of query aligns to 2:233/240 of 6mjpA
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
37% identity, 88% coverage: 13:237/255 of query aligns to 11:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
37% identity, 85% coverage: 23:239/255 of query aligns to 21:233/248 of 4fi3C
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 3:233/233 of 6b8bA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 3:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 3:233/238 of 6s8gA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 89% coverage: 1:227/255 of query aligns to 2:225/241 of 4u00A
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 3:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 3:233/234 of 4p31A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 3:233/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 92% coverage: 2:235/255 of query aligns to 4:234/241 of 6mbnA
5l22B Prtd t1ss abc transporter (see paper)
29% identity, 86% coverage: 12:231/255 of query aligns to 325:540/540 of 5l22B
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 88% coverage: 12:235/255 of query aligns to 330:553/865 of O65934
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
34% identity, 82% coverage: 1:208/255 of query aligns to 2:213/226 of 7mdyC
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 2:226/253 of 6z5uK
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 84% coverage: 1:214/255 of query aligns to 84:312/345 of Q9AT00
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 82% coverage: 1:208/255 of query aligns to 2:213/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 82% coverage: 1:208/255 of query aligns to 5:216/233 of P75957
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 4:228/263 of 7d0aB
>PfGW456L13_3770 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3770
MLRANNLLVRRGKRTVLTNIDIELRPGEVLGVLGPNGAGKSTLLAALCGELATSEGRVSL
DERPLADWPGQERAKRLAVLPQSSSLSFAFSVNEIVGMGRLPHASGRVRDAEIVAESLKA
ADALHLAGRSYLALSGGERQRVHLARVLAQLWPGAEGQTLLLDEPTSMLDPLHQHTILQA
VRDFAERGVAVLVILHDLNLAARYCDQLLLLHQGLPHAYGPPADVLTTETLAAVYGLQVL
IHQHPERGHPLIIAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory