Comparing PfGW456L13_3806 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3806 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 86% coverage: 31:398/429 of query aligns to 23:382/383 of 5i39A
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
27% identity, 49% coverage: 31:240/429 of query aligns to 15:217/433 of 5hxwA
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
25% identity, 48% coverage: 34:241/429 of query aligns to 7:204/824 of 4pabB
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 48% coverage: 34:241/429 of query aligns to 44:241/857 of Q63342
Sites not aligning to the query:
3hzlA Tyr258phe mutant of nikd, an unusual amino acid oxidase essential for nikkomycin biosynthesis: open form at 1.55a resolution (see paper)
29% identity, 31% coverage: 174:307/429 of query aligns to 136:260/394 of 3hzlA
Sites not aligning to the query:
>PfGW456L13_3806 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3806
MFQQSTRHVASYYAHTCADRLVDRAVLEGEQDTEVLIIGAGFSGLHTALRLALAGKRVTL
LEASRVAWAASGRNGGQAILGWSCDMPPLEAALGYERARRLWDGMRWAARELRDLPGRHE
FDCDYRAGHLWTSVMPRRVGLLTEWQHEASHKWGHDKLQFIERSDLPQWVASERYQAGLF
DPEGGHLNPLKLALGLADAIERAGGRIHEQSKALSYGEEGDGFVVTTERGRIRADVLVLA
CNAYLDRLDPQLASCVLPVGTYQVATAPLTKELATALLPSNVCVTDNQFVLDYFRRTPDN
RLLFGGGCTYLGGMPKDIAAATRPFLERVFPQLTGVDLEFAWGGHIDLTLKRTPDIGRRG
DLYWMQGYSGHGVLPTLAAARAVSDAVLGQPDELSLYQGLNNGSFPGGKYLAAPLEAIGK
AWYRLRDSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory