Comparing PfGW456L13_3873 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
62% identity, 100% coverage: 2:283/283 of query aligns to 1:282/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
62% identity, 100% coverage: 2:283/283 of query aligns to 1:282/283 of 4pzdA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
47% identity, 99% coverage: 3:283/283 of query aligns to 1:281/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
48% identity, 99% coverage: 3:282/283 of query aligns to 1:280/280 of 4kuhA
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
46% identity, 99% coverage: 4:283/283 of query aligns to 1:280/281 of 6aa8E
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 99% coverage: 3:282/283 of query aligns to 5:286/286 of P9WNP7
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
40% identity, 99% coverage: 3:282/283 of query aligns to 27:313/314 of P00348
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
41% identity, 99% coverage: 3:282/283 of query aligns to 4:290/291 of 1f0yA
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
41% identity, 99% coverage: 3:282/283 of query aligns to 4:290/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
41% identity, 99% coverage: 3:282/283 of query aligns to 4:290/293 of 1f12A
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
41% identity, 99% coverage: 3:282/283 of query aligns to 27:313/314 of Q16836
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
35% identity, 99% coverage: 2:282/283 of query aligns to 360:639/763 of P40939
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
37% identity, 99% coverage: 3:283/283 of query aligns to 316:599/711 of 7o4uA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
37% identity, 99% coverage: 3:283/283 of query aligns to 333:616/728 of 8oqlA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
37% identity, 99% coverage: 3:283/283 of query aligns to 334:617/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
37% identity, 99% coverage: 3:283/283 of query aligns to 335:618/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
37% identity, 99% coverage: 3:283/283 of query aligns to 334:617/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
37% identity, 99% coverage: 3:283/283 of query aligns to 334:617/729 of 8oqnA
Sites not aligning to the query:
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
37% identity, 99% coverage: 3:283/283 of query aligns to 334:617/729 of 8opvA
Sites not aligning to the query:
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
37% identity, 99% coverage: 3:283/283 of query aligns to 334:617/729 of 8opuA
Sites not aligning to the query:
>PfGW456L13_3873 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)
MNLQNIGVIGAGTMGNGIAQVCAMAGFNVTLLDISESALQKAVATVGKNLDRQIAKETLT
PEQKQAALDKIRTSTDYSSLQNAQLVIEAATENLDLKLRVLQQIAAQVSSECVIASNTSS
LSITQLAASVSQPERFIGLHFFNPVPVMGLIEVIRGLQTSDATHQLALDMATTLGKTAIT
AGNRPGFVVNRILVPMINEAILVFQEGLASAEDIDAGMRLGCNQPIGPLALADLIGLDTL
LSILEAFYDGFNDSKYRPAPLLKEMVAAGYLGRKTGRGFHAYA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory