SitesBLAST
Comparing PfGW456L13_3923 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3923 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 90% coverage: 4:361/400 of query aligns to 3:349/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), G10 (= G11), V11 (≠ Y12), I12 (≠ T13), V30 (≠ L31), E31 (= E32), K32 (≠ A33), E38 (≠ G39), A39 (= A40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (≠ Q47), V171 (≠ A182), G200 (= G209), G201 (≠ N210), W203 (≠ Y212), G298 (= G312), R300 (≠ F314), P301 (≠ L315), Y326 (vs. gap), R327 (vs. gap), N328 (vs. gap), G329 (= G341), I330 (≠ V342)
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 56% coverage: 136:359/400 of query aligns to 128:349/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y257), R302 (≠ F314), R329 (≠ G339)
- binding flavin-adenine dinucleotide: V174 (≠ A182), S202 (≠ G209), G203 (≠ N210), W205 (≠ Y212), F209 (≠ L216), G300 (= G312), R302 (≠ F314), H327 (≠ C337), R329 (≠ G339), N330 (≠ H340), G331 (= G341), I332 (≠ V342)
- binding phosphate ion: R254 (= R269)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 56% coverage: 136:359/400 of query aligns to 128:349/369 of O31616
- V174 (≠ A182) binding
- H244 (≠ Y250) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ F314) binding
- 327:333 (vs. 337:343, 14% identical) binding
- R329 (≠ G339) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
23% identity, 56% coverage: 136:359/400 of query aligns to 128:349/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P181), V174 (≠ A182), S202 (≠ G209), G203 (≠ N210), W205 (≠ Y212), F209 (≠ L216), G300 (= G312), R302 (≠ F314), H327 (≠ C337), F328 (≠ S338), R329 (≠ G339), N330 (≠ H340), G331 (= G341), I332 (≠ V342)
- binding glycolic acid: Y246 (= Y257), R302 (≠ F314), R329 (≠ G339)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
22% identity, 91% coverage: 2:364/400 of query aligns to 24:374/383 of 5i39A
- active site: F66 (≠ N44), Q69 (= Q47), A70 (≠ I48), Q248 (≠ S224), P267 (= P247)
- binding flavin-adenine dinucleotide: V30 (≠ I8), G31 (= G9), G33 (= G11), I34 (≠ Y12), L35 (≠ T13), V53 (≠ L31), E54 (= E32), K55 (≠ A33), Q62 (≠ A40), S63 (= S41), F66 (≠ N44), Y67 (≠ G45), Q69 (= Q47), A196 (≠ P181), A197 (= A182), G226 (= G209), G227 (≠ N210), W229 (vs. gap), Q248 (≠ S224), Q250 (≠ T229), G321 (= G312), M323 (≠ F314), T348 (≠ S338), G349 (= G339), W350 (≠ H340), G351 (= G341), M352 (≠ V342), T353 (= T343)
Q6TGQ9 L-amino-acid oxidase BjussuLAAO-I; BjsuLAAO; LAO; EC 1.4.3.2 from Bothrops jararacussu (Jararacussu) (see paper)
36% identity, 23% coverage: 5:94/400 of query aligns to 49:123/497 of Q6TGQ9
Sites not aligning to the query:
- 23 modified: Disulfide link with 186
- 186 modified: Disulfide link with 23
- 344 modified: Disulfide link with 425
- 425 modified: Disulfide link with 344
Query Sequence
>PfGW456L13_3923 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3923
VETDVCVIGAGYTGLSAALFLLENGFKVTVLEAARVGFGASGRNGGQIVNSYSRDIDVIE
RTVGPKQAQLLGQMAFEGGRIIRERVARYNIQCDLKDGGVFAAMTAKQMGHLESQKRLWE
RFGHTQLELMDQRRIREVVACDQYVGGMLDMSGGHIHPLNLALGEAAAVESLGGTIYEQS
PAVRIERGASPVVHTPQGKVRAKFIIVAGNAYLGNLVPELAAKSMPCGTQVITTEPLGEE
LAKTLLPQDYCVEDCNYLLDYYRLSGDKRLIFGGGVVYGARDPANIEAIIRPKMLKAFPQ
LKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYSQGCSGHGVTYTHLAGKVLAEALRGQA
ERFDAFADLPHYPFPGGQLLRTPFAALGAWYYGLRDKFGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory