SitesBLAST
Comparing PfGW456L13_3925 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
37% identity, 98% coverage: 7:408/412 of query aligns to 19:441/478 of Q47945
- Q37 (vs. gap) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
37% identity, 94% coverage: 23:408/412 of query aligns to 1:403/433 of 8gy2B
- binding heme c: C18 (= C40), C21 (= C43), H22 (= H44), T46 (= T68), I48 (= I70), Y59 (= Y81), L68 (= L90), R73 (= R95), V79 (≠ L101), Y80 (= Y102), M83 (= M105), F88 (≠ Y110), R126 (= R147), H165 (= H185), C166 (= C186), C169 (= C189), H170 (= H190), I201 (≠ L214), A202 (= A215), P203 (= P216), L205 (= L218), W216 (= W228), F224 (= F236), A234 (≠ T246), V235 (≠ M247), F236 (= F248), F236 (= F248), M239 (= M251), N301 (≠ V307), C302 (= C308), C305 (= C311), H306 (= H312), M316 (≠ I322), F317 (≠ A323), P318 (≠ V324), L320 (≠ M326), P324 (≠ T330), G342 (≠ I348), S352 (≠ H358), V354 (≠ Q360), M356 (= M362), F359 (= F365), M375 (≠ L381)
- binding ubiquinone-10: C21 (= C43), L34 (= L56), P39 (= P61), P81 (= P103), L129 (= L150), W132 (= W153), E168 (= E188), R173 (= R193), I197 (≠ L210), D241 (≠ P253)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
36% identity, 91% coverage: 28:402/412 of query aligns to 1:387/418 of 7w2jC
- binding heme c: C13 (= C40), C16 (= C43), H17 (= H44), T42 (= T68), I44 (= I70), Y55 (= Y81), L75 (= L101), Y76 (= Y102), A78 (= A104), M79 (= M105), R122 (= R147), H161 (= H185), C162 (= C186), C165 (= C189), H166 (= H190), A191 (= A215), P192 (= P216), R223 (≠ T246), P227 (≠ E250), M228 (= M251), V289 (= V307), C290 (= C308), C293 (= C311), H294 (= H312), Y305 (≠ I322), Y306 (≠ A323), P307 (≠ V324), L309 (≠ M326), N312 (= N329), T313 (= T330), T314 (= T331), D322 (≠ N339), I327 (= I344), V331 (≠ I348), R333 (≠ Q351), I340 (≠ H358), M342 (≠ Q360), P343 (= P361), F345 (≠ P363)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
34% identity, 91% coverage: 28:402/412 of query aligns to 1:401/413 of 8jejC
- binding heme c: C13 (= C40), C16 (= C43), H17 (= H44), T42 (= T68), I44 (= I70), F60 (= F86), L64 (= L90), L75 (= L101), Y76 (= Y102), M79 (= M105), P80 (= P106), Y84 (= Y110), R122 (= R147), C162 (= C186), C165 (= C189), H166 (= H190), I186 (≠ L210), W189 (≠ Y213), A191 (= A215), P192 (= P216), I194 (≠ L218), W205 (= W228), Y213 (≠ F236), R223 (≠ T246), M228 (= M251), V303 (= V307), C304 (= C308), C307 (= C311), H308 (= H312), Y320 (≠ A323), P321 (≠ V324), L323 (≠ M326), T327 (= T330), T328 (= T331), D336 (≠ N339), I341 (= I344), V345 (≠ I348), R347 (≠ Q351), I354 (≠ H358), M356 (≠ Q360), F359 (≠ P363), I376 (≠ L377)
- binding ubiquinone-10: M36 (≠ F62), P77 (= P103), S124 (≠ G149), W128 (= W153), C165 (= C189), L173 (≠ G197)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 89% coverage: 17:383/412 of query aligns to 31:409/440 of 8gy3A
- binding heme c: Y52 (≠ D39), C53 (= C40), C56 (= C43), H57 (= H44), S84 (≠ T68), I86 (= I70), W97 (≠ Y81), F102 (= F86), L117 (= L101), F121 (≠ M105), F126 (≠ Y110), R163 (= R147), C203 (= C186), C206 (= C189), H207 (= H190), A232 (= A215), P233 (= P216), L235 (= L218), W245 (= W228), Y253 (≠ F236), L254 (= L237), G263 (= G245), S264 (≠ T246), M269 (= M251), Y292 (≠ L274), C337 (= C308), C340 (= C311), H341 (= H312), P353 (= P320), L355 (≠ I322), N358 (= N329), N359 (≠ T330), V372 (= V343), I377 (= I348), G382 (= G355), Q383 (≠ F356), I386 (≠ M359), M388 (= M362), F391 (= F365)
- binding ubiquinone-10: E55 (≠ A42), T76 (≠ S60), F78 (= F62), Y118 (= Y102), P119 (= P103), I160 (≠ F144), G166 (≠ L150), Q167 (≠ M151), F169 (vs. gap), W170 (= W153), H202 (= H185), R210 (= R193), L213 (≠ P196)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
37% identity, 24% coverage: 304:401/412 of query aligns to 26:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C308), C33 (= C311), H34 (= H312), Y46 (≠ A323), P47 (≠ V324), T54 (= T331), V66 (= V343), I67 (= I344), R73 (≠ K352), I80 (≠ M359), M82 (= M362), P83 (= P363)
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
28% identity, 26% coverage: 297:402/412 of query aligns to 352:456/457 of 4ax3D
- binding heme c: C363 (= C308), C366 (= C311), H367 (= H312), P379 (≠ V324), P380 (≠ A325), L381 (≠ M326), S384 (≠ T330), F386 (≠ L332), N403 (vs. gap), G404 (= G349), S415 (≠ Q360), M417 (= M362), M420 (≠ F365)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
28% identity, 26% coverage: 297:402/412 of query aligns to 349:453/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ V307), C360 (= C308), C363 (= C311), H364 (= H312), P376 (≠ V324), P377 (≠ A325), L378 (≠ M326), F383 (≠ L332), N400 (vs. gap), G401 (= G349), Y410 (≠ H358), S412 (≠ Q360), M414 (= M362), M417 (≠ F365)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
28% identity, 26% coverage: 297:402/412 of query aligns to 350:454/456 of 5oboA
- binding heme c: T360 (≠ V307), C361 (= C308), C364 (= C311), H365 (= H312), P377 (≠ V324), P378 (≠ A325), L379 (≠ M326), S382 (≠ T330), F384 (≠ L332), I395 (≠ V343), N401 (vs. gap), G402 (= G349), S413 (≠ Q360), M415 (= M362), M418 (≠ F365)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
Query Sequence
>PfGW456L13_3925 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3925
MKLLLSRLALAVGLAAPVVAAHADDAQVKQGEYLARAADCMACHTAPGGAPYAGGLPIVS
PFGTIYGTNITPSKEHGIGLYNDDEFFAALTEGKRRDGANLYPAMPYTSYHLIPRADSDA
IHAYLKTVEPIERAAPVTSLSFPFNVRLGLMGWNMMYGKDVKLEPAEGKSEAWKRGQYMV
DVLGHCGECHTPRGLPGAMQMDKRMTGGILNGYLAPSLLATDLAARGWNHQDLSSFLKHG
MSAQGTMFNEMFPVFHNSTQGLSDPDLAAMATFLLGDQPPAAKVLVEVPLDKLSPSVQRG
RQEYLNVCAGCHAPGGEGKPHIAVAMRGNTTLRLEDPRNLVRVIDDGIGEQKFSGFEHMQ
PMPGFVDKLNDEQLTDLLNYLRQGWGGQPNDLAVNDVQKLRADAPPLEHKAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory