SitesBLAST
Comparing PfGW456L13_3930 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
91% identity, 100% coverage: 1:393/394 of query aligns to 2:394/395 of 3ekgA
- active site: K178 (= K177), P180 (= P179), G184 (= G183), S186 (≠ A185), E190 (= E189), D215 (= D214), W217 (= W216), E241 (= E240), T266 (= T265), G268 (= G267), E269 (= E268), Q290 (= Q289), D292 (= D291), H319 (= H318), E339 (= E338), D348 (= D347)
- binding magnesium ion: D215 (= D214), E241 (= E240), E269 (= E268)
3d46A Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and l-tartrate
62% identity, 100% coverage: 1:393/394 of query aligns to 5:404/405 of 3d46A
- active site: K189 (= K177), P191 (= P179), G195 (= G183), H197 (≠ A185), A201 (≠ E189), D226 (= D214), W228 (= W216), E252 (= E240), T277 (= T265), E280 (= E268), Q300 (= Q289), D302 (= D291), H329 (= H318), E349 (= E338), P362 (= P351)
- binding magnesium ion: D226 (= D214), E252 (= E240), E280 (= E268)
3cxoB Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
62% identity, 100% coverage: 1:393/394 of query aligns to 2:401/402 of 3cxoB
- active site: Y52 (= Y44), K186 (= K177), P188 (= P179), G192 (= G183), H194 (≠ A185), A198 (≠ E189), D223 (= D214), W225 (= W216), E249 (= E240), T274 (= T265), G276 (= G267), E277 (= E268), Q297 (= Q289), D299 (= D291), H326 (= H318), E346 (= E338), S351 (≠ A343)
- binding (2R,4S)-2,4,7-trihydroxyheptanoic acid: H30 (= H22), I42 (= I34), R56 (= R48), K186 (= K177), P188 (= P179), D223 (= D214), W225 (= W216), E277 (= E268), H326 (= H318), E346 (= E338)
- binding magnesium ion: D223 (= D214), E249 (= E240), E277 (= E268)
3cxoA Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
62% identity, 100% coverage: 1:393/394 of query aligns to 2:401/402 of 3cxoA
- active site: Y52 (= Y44), K186 (= K177), P188 (= P179), G192 (= G183), H194 (≠ A185), A198 (≠ E189), D223 (= D214), W225 (= W216), E249 (= E240), T274 (= T265), G276 (= G267), E277 (= E268), Q297 (= Q289), D299 (= D291), H326 (= H318), E346 (= E338), S351 (≠ A343)
- binding 3,6-dideoxy-L-arabino-hexonic acid: W37 (= W29), R56 (= R48), K186 (= K177), D223 (= D214), W225 (= W216), E277 (= E268), H326 (= H318), E346 (= E338)
- binding magnesium ion: D223 (= D214), E249 (= E240), E277 (= E268)
P77215 L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 from Escherichia coli (strain K12) (see paper)
62% identity, 100% coverage: 1:393/394 of query aligns to 1:400/401 of P77215
- H29 (= H22) mutation to N: Loss of L-rhamnonate dehydratase activity due to absence of substrate binding.
- H277 (= H269) mutation to N: 35-fold decrease in L-rhamnonate dehydratase activity. 59-fold decrease in substrate affinity.
- H325 (= H318) mutation to N: Loss of L-rhamnonate dehydratase activity. 2-fold decrease in substrate affinity.
3fxgA Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
49% identity, 98% coverage: 3:387/394 of query aligns to 7:393/407 of 3fxgA
- active site: K184 (= K177), P186 (= P179), E196 (= E189), D221 (= D214), Y223 (≠ W216), E247 (= E240), G273 (= G267), E274 (= E268), Q295 (= Q289), D297 (= D291), H324 (= H318), E344 (= E338)
- binding magnesium ion: D221 (= D214), E247 (= E240), E274 (= E268)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
33% identity, 82% coverage: 59:383/394 of query aligns to 44:375/386 of 3sqsA
- active site: L62 (≠ T76), N65 (≠ E79), S147 (vs. gap), K173 (= K177), R175 (≠ P179), G177 (≠ H181), G179 (= G183), K181 (≠ A185), A185 (≠ E189), E210 (≠ D214), Y212 (≠ W216), E236 (= E240), G261 (= G267), E262 (= E268), H263 (= H269), Q283 (= Q289), D285 (= D291), I307 (≠ A313), H312 (= H318), G314 (≠ S320), E332 (= E338), F337 (≠ A346)
- binding magnesium ion: E210 (≠ D214), E236 (= E240), E262 (= E268), Y347 (≠ H354), F350 (≠ L357), D351 (≠ L358)
3stpA Crystal structure of a putative galactonate dehydratase
33% identity, 84% coverage: 59:389/394 of query aligns to 48:385/390 of 3stpA
- active site: L66 (≠ T76), S69 (≠ E79), S151 (vs. gap), K177 (= K177), R179 (≠ P179), P189 (≠ E189), E214 (≠ D214), Y216 (≠ W216), E240 (= E240), G265 (= G267), E266 (= E268), H267 (= H269), Q287 (= Q289), D289 (= D291), I311 (≠ A313), H316 (= H318), E336 (= E338), F341 (≠ A346)
- binding magnesium ion: E214 (≠ D214), E240 (= E240), E266 (= E268)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
34% identity, 66% coverage: 60:318/394 of query aligns to 23:280/351 of 5olcC
- active site: K148 (= K177), K150 (≠ P179), D178 (= D214), N180 (≠ W216), E204 (= E240), G229 (= G267), E230 (= E268), D253 (= D291), H280 (= H318)
- binding magnesium ion: D178 (= D214), E204 (= E240), E230 (= E268)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
32% identity, 82% coverage: 59:383/394 of query aligns to 32:366/378 of 4hpnA
- active site: G50 (= G77), R53 (≠ E79), T134 (= T161), K164 (≠ P184), K166 (≠ E186), D194 (= D214), N196 (≠ W216), E220 (= E240), G245 (= G267), E246 (= E268), T247 (≠ H269), Q267 (= Q289), D269 (= D291), H296 (= H318), V297 (vs. gap), W298 (vs. gap), R320 (= R331), E329 (= E338), F330 (= F339), H334 (≠ V350)
- binding calcium ion: D194 (= D214), D209 (≠ V229), E220 (= E240), G237 (≠ N257), E246 (= E268)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
31% identity, 75% coverage: 89:385/394 of query aligns to 67:365/373 of 3sjnA
- active site: T139 (= T161), K165 (≠ L180), G167 (≠ H182), M171 (≠ E186), D198 (= D214), A200 (vs. gap), E225 (= E240), I247 (≠ V264), G250 (= G267), E251 (= E268), S252 (≠ H269), Q272 (= Q289), D274 (= D291), H301 (= H318), G302 (= G319), F303 (≠ S320), M325 (≠ A337), E326 (= E338), Q329 (≠ D347), S331 (≠ V349)
- binding magnesium ion: D198 (= D214), E225 (= E240), E251 (= E268)
Sites not aligning to the query:
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
31% identity, 83% coverage: 59:385/394 of query aligns to 32:350/357 of 3ck5A
- active site: T50 (≠ A73), G137 (= G150), K164 (= K177), K166 (≠ P179), D195 (= D214), N197 (≠ W216), I220 (= I239), E221 (= E240), I243 (≠ V264), G246 (= G267), E247 (= E268), E268 (≠ Q289), D270 (= D291), H297 (= H318), G298 (= G319), V299 (≠ S320), Y315 (≠ F336), E317 (= E338)
- binding magnesium ion: D195 (= D214), E221 (= E240), E247 (= E268)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
31% identity, 83% coverage: 59:385/394 of query aligns to 32:353/361 of Q9RKF7
- D195 (= D214) binding
- E221 (= E240) binding
- E247 (= E268) binding
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
32% identity, 58% coverage: 93:319/394 of query aligns to 73:301/367 of 5xd8B
- active site: G140 (vs. gap), K167 (= K177), K169 (≠ P179), D198 (= D214), N200 (≠ W216), E224 (= E240), G249 (≠ T265), E250 (≠ T266), Q271 (= Q289), D273 (= D291), H300 (= H318), G301 (= G319)
- binding magnesium ion: D198 (= D214), E224 (= E240), E250 (≠ T266)
Sites not aligning to the query:
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
27% identity, 79% coverage: 68:379/394 of query aligns to 37:375/397 of 2ox4C
- active site: K165 (= K177), D167 (≠ P179), E214 (≠ D214), H216 (≠ W216), E240 (= E240), G265 (= G267), E266 (= E268), Q287 (= Q289), D289 (= D291), H316 (= H318), E341 (≠ A343)
- binding magnesium ion: E214 (≠ D214), E240 (= E240), E266 (= E268)
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
29% identity, 90% coverage: 34:387/394 of query aligns to 37:382/395 of 2pp3A
- active site: K45 (≠ P42), S78 (≠ T75), K192 (= K177), A194 (= A185), D223 (= D214), N225 (≠ W216), E249 (= E240), G274 (= G261), E275 (vs. gap), D298 (= D291), H325 (= H318), E345 (= E338)
- binding l-glucaric acid: D43 (≠ K40), K79 (≠ T76), K192 (= K177), D223 (= D214), N225 (≠ W216), E275 (vs. gap), H325 (= H318), E345 (= E338), F347 (≠ L340)
- binding magnesium ion: D223 (= D214), E249 (= E240), E275 (vs. gap)
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
28% identity, 90% coverage: 34:387/394 of query aligns to 37:382/395 of 2pp1A
- active site: K45 (≠ P42), S78 (≠ T75), K192 (= K177), K194 (≠ P179), D223 (= D214), N225 (≠ W216), E249 (= E240), G274 (= G261), E275 (vs. gap), D298 (= D291), H325 (= H318), E345 (= E338)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: D43 (≠ K40), K45 (≠ P42), K79 (≠ T76), F168 (vs. gap), K194 (≠ P179), E275 (vs. gap), H325 (= H318), E345 (= E338)
- binding magnesium ion: D223 (= D214), E249 (= E240), E275 (vs. gap)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 90% coverage: 34:387/394 of query aligns to 40:385/398 of Q8ZL58
- DAK 46:48 (≠ KYP 40:42) binding
- KR 82:83 (≠ T- 76) binding
- K195 (= K177) binding
- K197 (≠ P179) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D214) binding
- N228 (≠ W216) binding
- E252 (= E240) binding
- E278 (vs. gap) binding
- H328 (= H318) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E338) binding
3tteA Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium complexed with magnesium and mandelic acid
31% identity, 87% coverage: 42:383/394 of query aligns to 18:351/361 of 3tteA
- active site: L23 (≠ S47), A54 (= A73), R57 (vs. gap), Q98 (≠ K118), S140 (≠ A160), K166 (= K177), K168 (≠ P179), D197 (= D214), N199 (≠ W216), E223 (= E240), G248 (= G267), E249 (= E268), N250 (≠ H269), M270 (≠ Q289), D272 (= D291), I294 (= I316), H299 (≠ S321), I300 (≠ V322), L301 (≠ Y323), H316 (≠ E338), E319 (= E348)
- binding magnesium ion: D197 (= D214), E223 (= E240), E249 (= E268)
- binding (s)-mandelic acid: K166 (= K177), D197 (= D214), N199 (≠ W216), E223 (= E240), E249 (= E268), H299 (≠ S321), E319 (= E348)
C8ZZN2 D-galactonate dehydratase family member EGBG_01401 from Enterococcus gallinarum (strain EG2) (see paper)
27% identity, 85% coverage: 59:391/394 of query aligns to 22:378/399 of C8ZZN2
- D205 (= D214) binding
- E231 (= E240) binding
- E257 (= E268) binding
Query Sequence
>PfGW456L13_3930 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3930
MGIPTIKHVRAFTLRGGGADYHDQADGHWIDDHIATPMSKYPEYRQSRRTFGINVLGTLV
VEIEASDGTVGFAVTTGGEPAAYIVEKHLARFLEGVRVTDIEKIWDQMYQSTLYYGRKGI
VINTISGVDLALWDLLGKIRQEPVHQLLGGAVRDELQFYATGARPDLAQKMGFIGGKMPL
HHGPAEGEEGLRKNLEELATMRERVGPDFWLMLDCWMSLDLNYATKLAVGAHEYGLKWIE
EALPPDDYWGYAALRNNVPKGMLVTTGEHEATRWGFRMLLEMGCCDIIQPDVGWCGGITE
LVKISALADAHNALVIPHGSSVYSYHFVATRHNSPFAEFLMMAPKADEVVPMFHPQLLGE
PVPVNGRMRLSALDQPGFGVTLNPECQLHRPYNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory