SitesBLAST
Comparing PfGW456L13_3934 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3934 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
44% identity, 97% coverage: 12:400/403 of query aligns to 1:392/396 of 4omaA
- active site: R59 (= R69), Y112 (≠ F122), D184 (= D194), K209 (= K219)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G97), I88 (≠ M98), Y112 (≠ F122), D184 (= D194), S206 (= S216), T208 (= T218), K209 (= K219), V337 (≠ A345), S338 (≠ N346), R373 (= R381)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
44% identity, 97% coverage: 12:400/403 of query aligns to 1:392/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
44% identity, 97% coverage: 12:400/403 of query aligns to 1:392/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
44% identity, 97% coverage: 12:400/403 of query aligns to 1:392/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
44% identity, 97% coverage: 12:400/403 of query aligns to 1:392/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
44% identity, 97% coverage: 12:400/403 of query aligns to 1:392/396 of 4hf8A
- active site: R59 (= R69), Y112 (≠ F122), D184 (= D194), K209 (= K219)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G97), I88 (≠ M98), Y112 (≠ F122), E155 (= E165), N159 (= N169), D184 (= D194), S206 (= S216), K209 (= K219), S338 (≠ N346), R373 (= R381)
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
44% identity, 96% coverage: 13:400/403 of query aligns to 1:391/395 of 5m3zA
- active site: R58 (= R69), Y111 (≠ F122), D183 (= D194), K208 (= K219)
- binding norleucine: Y111 (≠ F122), H113 (≠ S124), K208 (= K219), V336 (≠ A345), S337 (≠ N346)
- binding pyridoxal-5'-phosphate: G86 (= G97), I87 (≠ M98), Y111 (≠ F122), E154 (= E165), D183 (= D194), T185 (≠ C196), S205 (= S216), T207 (= T218), K208 (= K219)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G97), I87 (≠ M98), Y111 (≠ F122), D183 (= D194), S205 (= S216), T207 (= T218), K208 (= K219), V336 (≠ A345), S337 (≠ N346), R372 (= R381)
P9WGB5 O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
45% identity, 96% coverage: 15:401/403 of query aligns to 15:406/406 of P9WGB5
- K219 (= K219) modified: N6-(pyridoxal phosphate)lysine
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
43% identity, 97% coverage: 12:400/403 of query aligns to 1:381/386 of 3mkjA
- active site: Y101 (≠ F122), D173 (= D194), K198 (= K219)
- binding [5-hydroxy-4-(iminomethyl)-6-methyl-pyridin-3-yl]methyl dihydrogen phosphate: G76 (= G97), I77 (≠ M98), Y101 (≠ F122), E144 (= E165), D173 (= D194), F176 (= F197), S195 (= S216), T197 (= T218), K198 (= K219)
1e5fA Methionine gamma-lyase (mgl) from trichomonas vaginalis
38% identity, 95% coverage: 21:403/403 of query aligns to 7:392/393 of 1e5fA
- active site: R55 (= R69), Y108 (≠ F122), D181 (= D194), K206 (= K219)
- binding pyridoxal-5'-phosphate: Y53 (= Y67), R55 (= R69), G83 (= G97), M84 (= M98), Y108 (≠ F122), D181 (= D194), S203 (= S216), K206 (= K219)
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
38% identity, 95% coverage: 21:403/403 of query aligns to 7:392/394 of 1e5eA
- active site: R55 (= R69), Y108 (≠ F122), D181 (= D194), K206 (= K219)
- binding n-(hydroxy{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)norvaline: Y53 (= Y67), R55 (= R69), G83 (= G97), M84 (= M98), Y108 (≠ F122), N155 (= N169), D181 (= D194), S203 (= S216), T205 (= T218), K206 (= K219), S335 (≠ N346), T350 (≠ S361), R370 (= R381)
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
42% identity, 95% coverage: 22:402/403 of query aligns to 5:391/393 of 5x30C
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
42% identity, 95% coverage: 22:402/403 of query aligns to 4:390/392 of 5x2xA
- active site: R55 (= R69), Y108 (≠ F122), D180 (= D194), K205 (= K219)
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: Y53 (= Y67), R55 (= R69), G83 (= G97), M84 (= M98), Y108 (≠ F122), N155 (= N169), D180 (= D194), S202 (= S216), T204 (= T218), K205 (= K219), V333 (≠ A345), S334 (≠ N346), R369 (= R381)
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
42% identity, 95% coverage: 22:402/403 of query aligns to 4:390/392 of 5x2wA
- active site: R55 (= R69), Y108 (≠ F122), D180 (= D194), K205 (= K219)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-4-(methylsulfanyl)but-2-enoic acid: Y53 (= Y67), R55 (= R69), S82 (≠ T96), G83 (= G97), M84 (= M98), Y108 (≠ F122), D180 (= D194), S202 (= S216), K205 (= K219), V333 (≠ A345), S334 (≠ N346), R369 (= R381)
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
42% identity, 95% coverage: 22:402/403 of query aligns to 10:396/398 of 1pg8A
- active site: R61 (= R69), Y114 (≠ F122), D186 (= D194), K211 (= K219)
- binding pyridoxal-5'-phosphate: Y59 (= Y67), R61 (= R69), S88 (≠ T96), G89 (= G97), M90 (= M98), Y114 (≠ F122), D186 (= D194), S208 (= S216), T210 (= T218), K211 (= K219)
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
42% identity, 95% coverage: 22:402/403 of query aligns to 10:396/398 of P13254
- YSR 59:61 (= YSR 67:69) binding
- R61 (= R69) mutation R->A,E,F: Loss of elimination activity against L-methionine.
- GM 89:90 (= GM 97:98) binding in other chain
- Y114 (≠ F122) binding
- C116 (≠ S124) mutation to H: Drastic decrease of the catalytic efficiency of the elimination reaction with L-methionine, by 6700-fold, and increases that with L-cysteine by 7-fold, mainly due to changes in kcat. Loss of ability to catalyze replacement reaction between L-methionine and 2-mercaptoethanol.; mutation to S: 9% of wild-type elimination activity against L-methionine.; mutation to T: 40% of wild-type elimination activity against L-methionine.
- SAT 208:210 (= SAT 216:218) binding in other chain
- K211 (= K219) modified: N6-(pyridoxal phosphate)lysine
- K240 (≠ L246) mutation K->D,E: Marked decrease in elimination activity against both L-methionine and DL-homocysteine.; mutation to M: 50% reduction in alpha,gamma-elimination activity against DL-homocysteine, while retaining elimination activity against L-methionine and L-cysteine.
- D241 (≠ R247) mutation D->H,R: 5 to 14-fold reduction in alpha,gamma-elimination activity against L-methionine, while no change in affinity for L-methionine.
- R375 (= R381) binding
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
42% identity, 95% coverage: 22:402/403 of query aligns to 9:395/397 of 3vk3A
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
44% identity, 95% coverage: 17:400/403 of query aligns to 2:380/381 of 4iyoB
- active site: R47 (= R69), Y99 (≠ F122), D172 (= D194), K197 (= K219)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y67), R47 (= R69)
- binding amino-acrylate: Y99 (≠ F122), K197 (= K219), S326 (≠ N346), T341 (≠ S361), R361 (= R381)
- binding pyruvic acid: Q221 (≠ V242), F224 (= F245)
- binding serine: Y45 (= Y67), T48 (≠ Y70), Y99 (≠ F122), R104 (≠ S127), N227 (≠ T248), E325 (≠ A345)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
44% identity, 95% coverage: 17:400/403 of query aligns to 2:380/381 of 4iy7B
- active site: R47 (= R69), Y99 (≠ F122), D172 (= D194), K197 (= K219)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y67), R47 (= R69)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G97), M76 (= M98), Y99 (≠ F122), E143 (= E165), N147 (= N169), D172 (= D194), S194 (= S216), K197 (= K219), S326 (≠ N346), L327 (= L347), T341 (≠ S361), R361 (= R381)
- binding pyruvic acid: Q221 (≠ V242), F224 (= F245)
- binding serine: Y45 (= Y67), T48 (≠ Y70), Y99 (≠ F122), R104 (≠ S127), N227 (≠ T248), E325 (≠ A345)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
44% identity, 95% coverage: 17:400/403 of query aligns to 2:380/381 of 4iy7A
- active site: R47 (= R69), Y99 (≠ F122), D172 (= D194), K197 (= K219)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G97), M76 (= M98), Y99 (≠ F122), E143 (= E165), N147 (= N169), D172 (= D194), S194 (= S216), K197 (= K219), S326 (≠ N346), L327 (= L347), T341 (≠ S361), R361 (= R381)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y67), R47 (= R69)
- binding serine: Y45 (= Y67), T48 (≠ Y70), Y99 (≠ F122), R104 (≠ S127), N227 (≠ T248), E325 (≠ A345)
Query Sequence
>PfGW456L13_3934 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3934
MSQDWDAGRLDSDLEGVAFDTLAVRAGQHRTPEGEHGDPMFFTSSYVFRTAADAAARFAG
EVPGNVYSRYTNPTVRAFEERIAALESAEQAVATATGMAAIMAVVMSLCSAGDHVLVSRS
VFGSTISLFEKYFKRFGIEVDYVPLADLSGWDAAIKANTKLLFVESPSNPLAELVDIAEL
AKIAHAKGAMLVVDNCFCTPALQQPLKMGADIVVHSATKFIDGQGRCMGGVVAGRGEQMK
EVVGFLRTAGPTLSPFNAWIFLKGLETLNLRMKAHCANAQQLAEWLEQQDGIEKVHYAGL
KSHPQHELALRQQKGFGAVVSFEVKGGKEGAWRFIDATRLISITANLGDSKTTITHPSTT
SHGRLAPQEREAAGIRDSLIRVAVGLEDVADLQADLARGLAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory