SitesBLAST
Comparing PfGW456L13_398 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_398 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
40% identity, 41% coverage: 568:967/970 of query aligns to 2:395/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
34% identity, 43% coverage: 547:967/970 of query aligns to 2:419/423 of 5g4jA
- active site: S14 (≠ Q559), Y130 (= Y675), D201 (≠ E749), D234 (= D782), Q237 (= Q785), K264 (= K812), T294 (≠ S842), K395 (= K943)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (≠ L589), R73 (= R618), G103 (= G648), S104 (= S649), Y130 (= Y675), H131 (= H676), D234 (= D782), V236 (= V784), Q237 (= Q785), K264 (= K812), T294 (≠ S842), R397 (≠ K945)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
34% identity, 43% coverage: 547:967/970 of query aligns to 2:419/423 of 5g4iA
- active site: S14 (≠ Q559), Y130 (= Y675), D201 (≠ E749), D234 (= D782), Q237 (= Q785), K264 (= K812), T294 (≠ S842), K395 (= K943)
- binding pyridoxal-5'-phosphate: G103 (= G648), S104 (= S649), H131 (= H676), D234 (= D782), V236 (= V784), Q237 (= Q785), K264 (= K812)
- binding phosphate ion: Y44 (≠ L589), R397 (≠ K945)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1zobA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding calcium ion: L76 (≠ T615), S78 (= S617), V303 (≠ G844), S304 (≠ G845), D305 (≠ S846)
- binding pyridoxal-5'-phosphate: T108 (≠ S647), A110 (≠ S649), N113 (= N652), W136 (≠ Y675), H137 (= H676), E208 (= E749), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812)
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1zc9A
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G648), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812)
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1m0qA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (vs. gap), T108 (≠ S647), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), S213 (≠ N754), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1m0pA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (vs. gap), T108 (≠ S647), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), S213 (≠ N754), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1m0oA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (vs. gap), G109 (= G648), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1m0nA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (vs. gap), M51 (vs. gap), A110 (≠ S649), N113 (= N652), W136 (≠ Y675), H137 (= H676), E208 (= E749), S213 (≠ N754), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1dgdA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding pyridoxal-5'-phosphate: T108 (≠ S647), G109 (= G648), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812)
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1d7vA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding potassium ion: H75 (vs. gap), L76 (≠ T615), F77 (≠ N616), S78 (= S617), T301 (≠ S842), H302 (≠ A843), V303 (≠ G844), S304 (≠ G845), D305 (≠ S846)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), S213 (≠ N754), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1d7uA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding potassium ion: H75 (vs. gap), L76 (≠ T615), F77 (≠ N616), S78 (= S617), T301 (≠ S842), H302 (≠ A843), V303 (≠ G844), S304 (≠ G845), D305 (≠ S846)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G648), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1d7sA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (vs. gap), G109 (= G648), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
- binding potassium ion: H75 (vs. gap), L76 (≠ T615), F77 (≠ N616), S78 (= S617), T301 (≠ S842), H302 (≠ A843), V303 (≠ G844), S304 (≠ G845), D305 (≠ S846)
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
32% identity, 43% coverage: 552:970/970 of query aligns to 4:431/431 of 1d7rA
- active site: G19 (vs. gap), W136 (≠ Y675), E208 (= E749), D241 (= D782), Q244 (= Q785), K270 (= K812), T301 (≠ S842), R404 (≠ K943)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G648), A110 (≠ S649), W136 (≠ Y675), H137 (= H676), E208 (= E749), S213 (≠ N754), D241 (= D782), A243 (≠ V784), Q244 (= Q785), K270 (= K812), R404 (≠ K943)
- binding potassium ion: H75 (vs. gap), L76 (≠ T615), F77 (≠ N616), S78 (= S617), T301 (≠ S842), H302 (≠ A843), V303 (≠ G844), S304 (≠ G845), D305 (≠ S846)
5wyaA Structure of amino acid racemase, 2.65 a (see paper)
30% identity, 43% coverage: 541:956/970 of query aligns to 1:419/439 of 5wyaA
- active site: A20 (≠ Q559), Y140 (= Y675), E215 (= E749), D248 (= D782), N251 (≠ Q785), K278 (= K812), T307 (≠ S841), R406 (≠ K943)
- binding (2S,3S)-3-methyl-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pentanoic acid: A52 (≠ V592), Y82 (≠ R618), S112 (= S647), G113 (= G648), S114 (= S649), Y140 (= Y675), H141 (= H676), E215 (= E749), D248 (= D782), V250 (= V784), N251 (≠ Q785), K278 (= K812), F306 (= F840), T307 (≠ S841), R406 (≠ K943)
4ysnC Structure of aminoacid racemase in complex with plp (see paper)
30% identity, 43% coverage: 541:956/970 of query aligns to 10:428/448 of 4ysnC
- active site: A29 (≠ Q559), Y149 (= Y675), E224 (= E749), D257 (= D782), N260 (≠ Q785), K287 (= K812), T316 (≠ S841), R415 (≠ K943)
- binding pyridoxal-5'-phosphate: S121 (= S647), G122 (= G648), S123 (= S649), Y149 (= Y675), H150 (= H676), E224 (= E749), D257 (= D782), V259 (= V784), K287 (= K812), F315 (= F840), T316 (≠ S841)
5wyfA Structure of amino acid racemase, 2.12 a (see paper)
30% identity, 43% coverage: 541:956/970 of query aligns to 3:421/446 of 5wyfA
- active site: A22 (≠ Q559), Y142 (= Y675), E217 (= E749), D250 (= D782), N253 (≠ Q785), K280 (= K812), T309 (≠ S841), R408 (≠ K943)
- binding n-[o-phosphono-pyridoxyl]-isoleucine: A54 (≠ V592), Y84 (≠ R618), G115 (= G648), S116 (= S649), Y142 (= Y675), H143 (= H676), D222 (≠ N754), D250 (= D782), V252 (= V784), N253 (≠ Q785), K280 (= K812), F308 (= F840), T309 (≠ S841), R408 (≠ K943)
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
30% identity, 42% coverage: 555:966/970 of query aligns to 15:442/453 of 6g4dB
- active site: Y15 (≠ F555), Y146 (= Y675), D253 (= D782), K282 (= K812)
- binding pyridoxal-5'-phosphate: S112 (= S647), G113 (= G648), S114 (= S649), Y146 (= Y675), H147 (= H676), E220 (= E749), D253 (= D782), V255 (= V784), I256 (≠ Q785), K282 (= K812)
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
30% identity, 42% coverage: 555:966/970 of query aligns to 15:442/451 of 6g4fA
- active site: Y15 (≠ F555), Y146 (= Y675), D253 (= D782), K282 (= K812)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S112 (= S647), G113 (= G648), S114 (= S649), Y146 (= Y675), H147 (= H676), E220 (= E749), D253 (= D782), V255 (= V784), I256 (≠ Q785), K282 (= K812)
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
30% identity, 42% coverage: 555:966/970 of query aligns to 15:442/451 of 6g4eA
- active site: Y15 (≠ F555), Y146 (= Y675), D253 (= D782), K282 (= K812)
- binding 6-aminohexanoic acid: K282 (= K812), R412 (≠ Q933), M414 (≠ T935)
- binding pyridoxal-5'-phosphate: S112 (= S647), G113 (= G648), S114 (= S649), Y146 (= Y675), H147 (= H676), E220 (= E749), D253 (= D782), V255 (= V784), I256 (≠ Q785), K282 (= K812)
Query Sequence
>PfGW456L13_398 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_398
MPLATLIHRASLPSPQVSAEQALGLLEEHYGFSGRLQALGSQQDLNYRVDSERGRFVLKI
CRGDYSVLELQAQHAGLKHLGEHPDVNVPRVIAAKNGADLLSLDVGGQAVHVRLLDYIEG
QPLTSLGHFNPTVVSGFGRLCGEMDLALADFDHPGLVRTLQWDARHAHALIAHLLPVIKD
EAQRKLIVEASGQAERHLQPLQDKLPVQAIHMDITDDNVVWQRDAQRHWQLQGVIDFGDL
VRTWRITDLSVTCAALLHHGEGDPFCILPAIQAYHAVNPLQHEELLALWPLIVARAAVLV
LSGEQQVSIDPGNAYSRDNLVHEWEIFRVATSVPLALMEAAILTAVGQNLPTIGSEGFAP
LLPSLVGREFALIDLGVLSPHFEAGNWEQEGVDQRLLDEAAAAHGLAASRYGQYRLSHTR
PDSAAEPDTCPLHVELRVPQGTAVEAPFAGVVHQPSAGVLHLDGPQLSVRLWGVTPSLHS
GAALVKGQVLGSVSGLLIVQLCRGASIDAPLFCTPSRAAAWQALCPSPAALLGLACDAEA
ELDGATLLARRDASFARTQKHYYVDPPRIERGWRNHLIDMQGRSYLDMLNNVAVLGHGHP
RMAAVASRQWSLLNTNSRFNYAAVAEFSERLLKLSPDGMDRVFLVNSGSEANDLAIRLAW
AYSGGRDMLSVLEAYHGWTVGADSVSTSIADNPKALSSRPDWVHPVTAPNTYRGEFRGPD
SAPDYVRSVEHNLAKIAEQKRQLAGFICEPVYGNAGGISLPPGYLKQVYAMVRARGGVCI
ADEVQVGYGRMGDFFWGFEEQGVVPDIITMAKGMGNGQPLGAVITRREIAEALEAEGYFF
SSAGGSPVSCQVGMAVLDVMQEEKLWENAQVVGGHFKERLEALIDIHPLVGAVHGSGFYL
GVELIRNRETLEPATEETTALCDRLRELGIFMQPTGDYLNILKIKPPMVTSRQSVDFFVD
MLSKVLAEGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory