Comparing PfGW456L13_403 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
27% identity, 88% coverage: 8:248/275 of query aligns to 7:246/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
27% identity, 88% coverage: 8:248/275 of query aligns to 9:248/277 of P20456
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
25% identity, 98% coverage: 5:274/275 of query aligns to 4:271/274 of 4as5A
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
26% identity, 89% coverage: 5:248/275 of query aligns to 2:244/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
26% identity, 89% coverage: 5:248/275 of query aligns to 2:244/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
26% identity, 89% coverage: 5:248/275 of query aligns to 2:244/272 of 1awbA
6giuA Human impase with l-690330 (see paper)
26% identity, 89% coverage: 5:248/275 of query aligns to 4:246/275 of 6giuA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
26% identity, 89% coverage: 5:248/275 of query aligns to 6:248/277 of P29218
6zk0AAA human impase with ebselen (see paper)
26% identity, 89% coverage: 5:248/275 of query aligns to 3:245/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
26% identity, 89% coverage: 5:248/275 of query aligns to 4:246/274 of 4as4A
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
26% identity, 89% coverage: 5:248/275 of query aligns to 2:244/266 of 1imdA
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
25% identity, 98% coverage: 5:274/275 of query aligns to 6:273/277 of O55023
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
30% identity, 86% coverage: 12:247/275 of query aligns to 24:258/288 of O14732
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 88% coverage: 14:256/275 of query aligns to 93:325/346 of Q6NPM8
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
30% identity, 86% coverage: 12:247/275 of query aligns to 10:235/259 of 2cziA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
32% identity, 76% coverage: 32:240/275 of query aligns to 28:230/255 of 5yhtA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
32% identity, 76% coverage: 32:240/275 of query aligns to 29:231/256 of 5zonA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 76% coverage: 32:240/275 of query aligns to 31:233/260 of P95189
5djkA Structure of m. Tuberculosis cysq, a pap phosphatase with po4 and 2ca bound (see paper)
30% identity, 76% coverage: 38:245/275 of query aligns to 29:221/251 of 5djkA
5djjA Structure of m. Tuberculosis cysq, a pap phosphatase with po4 and 2mg bound (see paper)
30% identity, 76% coverage: 38:245/275 of query aligns to 35:227/257 of 5djjA
>PfGW456L13_403 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_403
MNFPHPLMAPVIELALQAGEAILPFWRTGTAVTAKADDSPVTAADLAAHHLILAGLTALD
PSIPVLSEEDANIPQDVRAGWQRWWLVDPLDGTKEFISGSEEFTVNIALIENGRVVFGVV
SMPTNGRFYVGGAGLGAWRGDKGGTPVAIKVRDALAPGESFTVVASRRHSSPEQERLLAG
LSASLGELQLANIGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLELSG
EPFSYPARASLLNAFFLALPAKAAWREKLLELARS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory