Comparing PfGW456L13_4288 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4288 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
93% identity, 100% coverage: 1:416/416 of query aligns to 1:416/416 of P83788
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
94% identity, 97% coverage: 2:405/416 of query aligns to 1:404/404 of 1qz9A
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
26% identity, 94% coverage: 8:400/416 of query aligns to 31:459/464 of P70712
Sites not aligning to the query:
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
27% identity, 94% coverage: 8:400/416 of query aligns to 26:445/446 of 3e9kA
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
27% identity, 94% coverage: 8:400/416 of query aligns to 26:446/447 of 2hzpA
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
27% identity, 94% coverage: 8:400/416 of query aligns to 31:459/465 of Q16719
Sites not aligning to the query:
1m32A Crystal structure of 2-aminoethylphosphonate transaminase (see paper)
25% identity, 50% coverage: 64:270/416 of query aligns to 21:224/361 of 1m32A
Sites not aligning to the query:
P96060 2-aminoethylphosphonate--pyruvate transaminase; 2-aminoethylphosphonate aminotransferase; AEP transaminase; AEPT; EC 2.6.1.37 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
25% identity, 50% coverage: 64:270/416 of query aligns to 26:229/367 of P96060
Sites not aligning to the query:
1m32B Crystal structure of 2-aminoethylphosphonate transaminase (see paper)
25% identity, 50% coverage: 64:270/416 of query aligns to 22:225/362 of 1m32B
Sites not aligning to the query:
7tlmA Structure of atopobium parvulum sufs (see paper)
23% identity, 49% coverage: 154:356/416 of query aligns to 157:356/415 of 7tlmA
Sites not aligning to the query:
8odqD Sufs-sufu complex from mycobacterium tuberculosis (see paper)
25% identity, 64% coverage: 83:347/416 of query aligns to 78:339/410 of 8odqD
7tlpA Structure of atopobium parvulum sufs k235r (see paper)
27% identity, 25% coverage: 154:255/416 of query aligns to 148:247/391 of 7tlpA
Sites not aligning to the query:
7tlpB Structure of atopobium parvulum sufs k235r (see paper)
27% identity, 25% coverage: 154:255/416 of query aligns to 150:249/393 of 7tlpB
Sites not aligning to the query:
1vjoA Crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. At 1.70 a resolution (see paper)
29% identity, 26% coverage: 134:242/416 of query aligns to 103:220/377 of 1vjoA
Sites not aligning to the query:
3lvmB Crystal structure of e.Coli iscs (see paper)
33% identity, 15% coverage: 156:219/416 of query aligns to 141:204/394 of 3lvmB
Sites not aligning to the query:
P0A6B7 Cysteine desulfurase IscS; NifS protein homolog; ThiI transpersulfidase; TusA transpersulfidase; EC 2.8.1.7 from Escherichia coli (strain K12) (see 4 papers)
33% identity, 15% coverage: 156:219/416 of query aligns to 135:198/404 of P0A6B7
Sites not aligning to the query:
P0A6B9 Cysteine desulfurase IscS; EC 2.8.1.7 from Escherichia coli O157:H7 (see paper)
33% identity, 15% coverage: 156:219/416 of query aligns to 135:198/404 of P0A6B9
Sites not aligning to the query:
>PfGW456L13_4288 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4288
MTTRNDCLALDAQDALAPLRQQFALPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGL
IRSWNSAGWRDLPERLGNRLGGLIGAGDGEVVVTDTTSINLFKVLSAALRVQATRAPTRR
VIVTETGNFPTDLYIAEGLADMLQQGYTLRLVDSPQELPQAIDQDTAVVMLTHVNYKTGY
MHDMQALTTLTHECGALAIWDLAHSAGAVPVDLHQARADYAIGCTYKYLNGGPGSQAFVW
VSPELCDLVAQPLSGWFGHSRQFAMESHYQPSSGIARYLCGTQPITSLAMVECGLDVFAQ
TDMASLRSKSLALTDLFIQLVEQRCAAHELTLVTPREHAKRGSHVSFEHPQGYAVIQALI
ARGVIGDYREPRIMRFGFTPLYTSFTEVWDAVQILGDILDQKTWSQEQFQIRHSVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory