Comparing PfGW456L13_43 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_43 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
47% identity, 97% coverage: 20:635/637 of query aligns to 6:628/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
47% identity, 97% coverage: 20:635/637 of query aligns to 5:627/629 of 3n2oB
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
44% identity, 96% coverage: 22:635/637 of query aligns to 5:622/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 2:612/637 of query aligns to 22:630/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
33% identity, 97% coverage: 23:637/637 of query aligns to 4:580/591 of 3nzpB
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
26% identity, 44% coverage: 85:365/637 of query aligns to 39:300/422 of 6n2aA
Sites not aligning to the query:
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
26% identity, 47% coverage: 70:366/637 of query aligns to 13:269/385 of 2yxxA
Sites not aligning to the query:
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
26% identity, 47% coverage: 70:366/637 of query aligns to 14:270/386 of Q9X1K5
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
26% identity, 38% coverage: 127:366/637 of query aligns to 39:279/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
25% identity, 37% coverage: 127:359/637 of query aligns to 41:275/405 of B4XMC6
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
27% identity, 40% coverage: 107:359/637 of query aligns to 57:289/418 of 4xg1B
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
23% identity, 48% coverage: 53:359/637 of query aligns to 16:306/434 of 1tufA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
23% identity, 48% coverage: 53:359/637 of query aligns to 20:310/438 of Q58497
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
23% identity, 48% coverage: 53:359/637 of query aligns to 16:306/434 of 1twiA
Sites not aligning to the query:
7kh2D Structure of n-citrylornithine decarboxylase bound with plp (see paper)
24% identity, 43% coverage: 98:368/637 of query aligns to 53:310/415 of 7kh2D
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
24% identity, 47% coverage: 70:368/637 of query aligns to 42:323/442 of 5x7nA
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
24% identity, 47% coverage: 70:368/637 of query aligns to 42:323/443 of 5x7mA
Sites not aligning to the query:
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
27% identity, 36% coverage: 129:359/637 of query aligns to 65:285/412 of 7ru7A
Sites not aligning to the query:
2pljA Crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus (see paper)
27% identity, 33% coverage: 90:300/637 of query aligns to 34:225/376 of 2pljA
Sites not aligning to the query:
2plkA Crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus (see paper)
27% identity, 33% coverage: 90:300/637 of query aligns to 30:220/370 of 2plkA
Sites not aligning to the query:
>PfGW456L13_43 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_43
MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINDAGRVEVRPNGPSSSPIDLYEQVD
QLRKSGLSLPLLVRFPDILQDRVRQLTGAFDANIERLEYQSKYTALYPIKVNQQEAVIEN
IIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDREFIRLALMGQKLGHNVFIVI
EKESEVGLVIEEAASLKVKPQVGLRVRLSSLASSKWADTGGEKSKFGLSAAQLLSVVERF
RAAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRYYGELRNLGLPVDHIDVGGGLGVDY
DGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQSLPHPNIFSESGRSLTAHHAMLVIQVT
DVEKHNDDVPQIENKEALPETVQWLVDLLGPTDIEMVTETYWRATHYMSDVASQYADGKL
TLAEKALAEQCYFAVCRRLHNSLKARQRSHRQVLDELNDKLADKYICNFSVFQSLPDTWA
IDQVLPIIPLHRLDEEPLRRAVLQDLTCDSDGKINQYVDEQSIETSLPVHALKEGEDYLL
GVFLVGAYQEILGDMHNLFGDTDSVNIYQNADGSVYHAGIETHDTIEDMLRYVHLSPEEL
MTHYRDKCASARISATERTQFLDALRLGLTRSSYLSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory