Comparing PfGW456L13_4459 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4459 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
33% identity, 97% coverage: 1:258/267 of query aligns to 1:264/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
33% identity, 97% coverage: 1:258/267 of query aligns to 1:261/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
33% identity, 97% coverage: 1:258/267 of query aligns to 1:258/262 of 6eb3C
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
27% identity, 97% coverage: 1:258/267 of query aligns to 1:260/261 of 2xuaH
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
26% identity, 95% coverage: 7:259/267 of query aligns to 9:268/269 of 5h3hB
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
26% identity, 96% coverage: 3:258/267 of query aligns to 9:274/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
26% identity, 96% coverage: 3:258/267 of query aligns to 9:274/276 of 4lxiA
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
26% identity, 96% coverage: 3:258/267 of query aligns to 9:274/276 of 4lxhA
Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase; HOPDA; EC 3.7.1.13 from Pseudomonas resinovorans (see paper)
30% identity, 94% coverage: 8:258/267 of query aligns to 25:280/290 of Q9AQM4
7p4kA Soluble epoxide hydrolase in complex with fl217 (see paper)
24% identity, 93% coverage: 11:259/267 of query aligns to 22:310/313 of 7p4kA
5alsA Ligand complex structure of soluble epoxide hydrolase (see paper)
24% identity, 93% coverage: 11:259/267 of query aligns to 249:538/541 of 5alsA
7a7gA Soluble epoxide hydrolase in complex with tk90 (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 22:314/317 of 7a7gA
5aljA Ligand complex structure of soluble epoxide hydrolase (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 236:520/523 of 5aljA
5akkA Ligand complex structure of soluble epoxide hydrolase (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 246:538/541 of 5akkA
7ebaA Co-crystal of kurarinone with seh (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 20:314/316 of 7ebaA
8qn0A Soluble epoxide hydrolase in complex with rk3 (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 25:319/322 of 8qn0A
6i5gA X-ray structure of human soluble epoxide hydrolasE C-terminal domain (hseh ctd)in complex with 15d-pgj2 (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 21:315/316 of 6i5gA
6yl4A Soluble epoxide hydrolase in complex with 3-((r)-3-(1-hydroxyureido) but-1-yn-1-yl)-n-((s)-3-phenyl-3-(4-trifluoromethoxy)phenyl)propyl) benzamide (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 22:316/319 of 6yl4A
6kxhB Alp1u_y247f mutant in complex with fluostatin c (see paper)
27% identity, 94% coverage: 8:258/267 of query aligns to 27:294/294 of 6kxhB
6hgxA Soluble epoxide hydrolase in complex with 1-(4-((4-(tert-butyl) morpholin-2-yl)methoxy)phenyl)-3-cyclohexylurea (see paper)
23% identity, 93% coverage: 11:259/267 of query aligns to 22:316/319 of 6hgxA
>PfGW456L13_4459 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4459
MAYFEHEGCNLHYEEYGHGTPLLLVHGLGSSTLDWEKQIPTLATRYRVIVPDVRGHGRSD
KPQERYSIAGFSADLIALIEHLNLGPAHYVGLSMGGMIGFQLGVDQPQLLKSLCIVNSAP
EVKLRSRDDYWQWFKRWSLMHALSLRTIGKALGSKLFPKPEQADLRQKMAERWAKNDKHA
YLASFNAIVGWGVQERLSKVTCPTLIVSADRDYTPVALKENYVKLLPDARLVVIADSRHA
TPLDQPEHFNQTLLEFLSAVDTTTQDH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory