Comparing PfGW456L13_4526 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4526 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
27% identity, 87% coverage: 29:310/325 of query aligns to 8:284/300 of 2dvzA
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
27% identity, 68% coverage: 25:246/325 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
7ndsA Crystal structure of tphc in a closed conformation (see paper)
24% identity, 70% coverage: 29:256/325 of query aligns to 6:221/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
24% identity, 70% coverage: 29:256/325 of query aligns to 6:221/293 of 7ndrD
2f5xB Structure of periplasmic binding protein bugd (see paper)
26% identity, 61% coverage: 126:323/325 of query aligns to 103:297/300 of 2f5xB
Sites not aligning to the query:
>PfGW456L13_4526 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4526
MNLSMRKIALAASVLLFTGHALAEPKRPECIAPASPGGGFDLTCKLAQSALVNEKLLTKP
MRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDESHVRWLAAVG
TSYGAIAVKSDSPYKTLDDLVQALKKDPSKVVIGSGGTVGSQDWMQTALIAKAAGINPRD
LRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFSDKRLDEPEMKDIP
TAREQGYDIVWPVVRGFYLGPKVSDEDYAWWKDSFDKLLASPEFAKLRDQRELFPFAMTG
PELDTYVKKQVADYKVLAKEFGLIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory