Comparing PfGW456L13_4553 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4553 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
75% identity, 99% coverage: 4:295/295 of query aligns to 1:291/291 of 3na8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 97% coverage: 6:292/295 of query aligns to 2:286/292 of Q07607
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 98% coverage: 6:295/295 of query aligns to 2:286/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 98% coverage: 6:295/295 of query aligns to 2:286/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 98% coverage: 6:295/295 of query aligns to 2:286/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 98% coverage: 6:295/295 of query aligns to 2:286/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 98% coverage: 6:295/295 of query aligns to 2:286/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 98% coverage: 6:295/295 of query aligns to 2:286/291 of 3pueB
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
28% identity, 97% coverage: 9:295/295 of query aligns to 14:302/306 of 7kkdB
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
28% identity, 97% coverage: 9:295/295 of query aligns to 4:292/296 of 4m19A
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
28% identity, 97% coverage: 9:295/295 of query aligns to 4:292/296 of 7kg2A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
28% identity, 97% coverage: 9:295/295 of query aligns to 4:292/296 of 6u01B
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
33% identity, 81% coverage: 8:245/295 of query aligns to 4:240/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
33% identity, 81% coverage: 8:245/295 of query aligns to 4:240/294 of Q8UGL3
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
30% identity, 77% coverage: 8:235/295 of query aligns to 5:234/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
30% identity, 77% coverage: 8:235/295 of query aligns to 5:234/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 77% coverage: 8:235/295 of query aligns to 5:234/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 77% coverage: 8:235/295 of query aligns to 5:234/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 77% coverage: 8:235/295 of query aligns to 5:234/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
30% identity, 77% coverage: 8:235/295 of query aligns to 5:234/298 of 3nevA
>PfGW456L13_4553 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4553
MSTANIHGIIGYTITPFTPHGEGVDLDALGRSIDRLIEGGVHAIAPLGSTGEGAYLSDAE
WDQVSEFSIRHVARRVPTVVSVSDLTTAKAVRRARFAEAHGADVVMVLPTSYWKLSEAEI
LAHYRAIGDSIGVPIMLYNNPATSGTDMSVDLILRIVNAVENVTMVKESTGDIQRMHQLQ
RLGEGQVPFYNGCNPLALEAFAAGAKGWCTAAPNLIPQLNLDLYEAVLANDLRKARELFY
RQLPLLDFILKGGLPATIKAGLRATGLEVGDPRLPVFPLSEAGCDQQEDLLKALR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory