Comparing PfGW456L13_4585 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
50% identity, 95% coverage: 10:260/263 of query aligns to 10:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 98% coverage: 3:260/263 of query aligns to 3:263/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
32% identity, 98% coverage: 3:260/263 of query aligns to 3:260/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 98% coverage: 3:260/263 of query aligns to 3:257/262 of 6eb3C
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
28% identity, 97% coverage: 8:261/263 of query aligns to 14:268/274 of 4uhdA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
28% identity, 97% coverage: 8:261/263 of query aligns to 14:268/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
28% identity, 97% coverage: 8:261/263 of query aligns to 14:268/278 of 4uhfA
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 17:249/264 of 5zhsA
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 18:250/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 18:250/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 18:250/265 of 5yz7A
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 21:253/268 of 4ihaA
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
27% identity, 86% coverage: 23:248/263 of query aligns to 71:303/318 of Q10QA5
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 19:251/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 19:251/266 of 5dj5A
6brtA F-box protein cth with hydrolase (see paper)
27% identity, 86% coverage: 23:248/263 of query aligns to 38:270/285 of 6brtA
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
23% identity, 95% coverage: 12:262/263 of query aligns to 10:267/269 of O07015
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
22% identity, 99% coverage: 2:262/263 of query aligns to 3:268/269 of 5h3hB
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
23% identity, 88% coverage: 23:254/263 of query aligns to 21:259/267 of Q9SQR3
A0A109QYD3 Strigolactone esterase RMS3; Protein DWARF 14 homolog; PsD14; Protein RAMOSUS 3; EC 3.1.-.- from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
22% identity, 86% coverage: 24:248/263 of query aligns to 21:253/267 of A0A109QYD3
Sites not aligning to the query:
>PfGW456L13_4585 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4585
VAFVQLAEGELHYQLDGPVDAPVLVLSNSLGTDLHMWDAQIPAFSKHFRVLRFDTRGHGQ
SLVTPGPYSIEQLGRDVLALLDALHIERAHFCGLSMGGLIGQWLGINAGDRLNQLIVCNT
AAKIGDPSVWNPRIEMVLRDGQAAMVALRDASIARWFTPDFSEANPAAAKQITDMLAATS
PEGYAANCAAVRDADFRDQLSSIKAPLLVIAGTEDAVTPPSGGHFIQEHVPGAEYAEFYA
AHLSNVQAGADFSECVLAFLKAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory