SitesBLAST
Comparing PfGW456L13_4587 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 76% coverage: 51:382/434 of query aligns to 32:381/446 of A0A0H2VG78
- R102 (= R130) mutation to A: Loss of transport activity.
- I105 (≠ Q133) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E150) mutation to A: Loss of transport activity.
- Q137 (≠ Y165) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (≠ G255) mutation to A: Loss of transport activity.
- W357 (≠ G358) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 49% coverage: 15:226/434 of query aligns to 36:258/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
21% identity, 64% coverage: 87:365/434 of query aligns to 100:409/512 of Q6PXP3
- I302 (≠ T263) mutation to S: Does not affect glucose or fructose transport.; mutation to V: Abolished fructose transport.
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
27% identity, 43% coverage: 55:240/434 of query aligns to 60:238/487 of 7aaqA
Sites not aligning to the query:
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 44% coverage: 50:240/434 of query aligns to 75:258/514 of Q9LT15
- C77 (≠ F52) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E150) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q164) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ S177) mutation to A: Reduces affinity for glucose 3-fold.
Sites not aligning to the query:
- 39 F→A: Reduces affinity for glucose 8-fold.
- 43 L→A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- 295 binding
- 296 binding
- 301 binding
- 332 binding
- 344 D→N: Abolishes glucose transport activity; when associated with Q-162.
- 410 binding
- 449 modified: Disulfide link with 77; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
26% identity, 43% coverage: 55:240/434 of query aligns to 65:243/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : I90 (≠ L85), H94 (= H89), V98 (≠ N93), F101 (≠ L96), N138 (≠ Y141), P142 (≠ A145), N158 (≠ A161), F161 (= F163), Q162 (= Q164), I165 (≠ T167), D210 (vs. gap)
Sites not aligning to the query:
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
35% identity, 19% coverage: 77:158/434 of query aligns to 203:276/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 36% coverage: 85:239/434 of query aligns to 90:229/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
26% identity, 69% coverage: 83:383/434 of query aligns to 78:390/452 of Q5EXK5
- D82 (= D87) mutation to A: Loss of activity.
- V311 (≠ M301) mutation to W: Loss of activity.
- D314 (= D304) mutation to A: Loss of activity.
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 35% coverage: 77:228/434 of query aligns to 117:281/587 of P25297
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
34% identity, 19% coverage: 77:158/434 of query aligns to 203:276/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Query Sequence
>PfGW456L13_4587 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4587
MTTPTAPIALYTGEERSKRIFAIVGASSGNLVEWFDFYVYAFCAIYFAPAFFPSDNPTVQ
LVNTAGVFAAGFLIRPIGGWIFGRLADKHGRKNSMLISILMMCFGSLLIACLPTYSSIGV
WAPILLLFARLLQGLSVGGEYGTTATYMSEVALKGQRGFFASFQYVTLIGGQLLAVSLVV
VLQQFLTEDDLRAYGWRIPFVVGAMAALVSLYLRRSLKETTSKAMRENKDAGSISALFRD
HKTAFITVLGYTAGGSLIFYTFTTYMQKYLVNTAGMPAKTASYIMTGALFLYMCMQPIFG
MLADKIGRRNSMLWFGALGTLCTVPILLSLKSVTSPFLAFVLITLALAIVSFYTSISGLV
KAEMFPPEVRALGVGLAYAVANAIFGGSAEYVALSLKAVGMENSFYWYVTVMMAIAFLFS
LRLPKQAKYLHHDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory