Comparing PfGW456L13_4591 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4591 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5mzyB Crystal structure of the decarboxylase aiba/aibb in complex with a possible transition state analog (see paper)
27% identity, 95% coverage: 1:245/259 of query aligns to 3:233/244 of 5mzyB
5mzzB Crystal structure of the decarboxylase aiba/aibb in complex with 3- methylglutaconate (see paper)
28% identity, 93% coverage: 4:245/259 of query aligns to 3:230/241 of 5mzzB
5mzxB Crystal structure of the decarboxylase aiba/aibb in complex with 4'- diphospho pantetheine (see paper)
28% identity, 93% coverage: 4:245/259 of query aligns to 3:230/241 of 5mzxB
Q0S7Q0 Cholesterol ring-cleaving hydrolase IpdB subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase beta subunit; COCHEA-CoA hydrolase beta subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
29% identity, 83% coverage: 29:244/259 of query aligns to 36:240/253 of Q0S7Q0
6cojB Crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex (see paper)
29% identity, 83% coverage: 29:244/259 of query aligns to 31:235/248 of 6cojB
Sites not aligning to the query:
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
27% identity, 58% coverage: 7:155/259 of query aligns to 303:452/520 of Q29551
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
27% identity, 58% coverage: 7:155/259 of query aligns to 251:400/468 of 1o9lA
Sites not aligning to the query:
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
27% identity, 58% coverage: 7:155/259 of query aligns to 250:399/466 of 3k6mC
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
27% identity, 55% coverage: 13:155/259 of query aligns to 252:395/462 of 3oxoE
>PfGW456L13_4591 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4591
MTYTTNEMMTVAAARRLKNGSVCFVGIGLPSKAANLARLTSSPDVVLIYESGPIGAKPSV
LPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQVDRFGNINTTVVGDYHAP
KVRLPGAGGAPEIAGSAKSVLIILKQSSRSFVDKLDFITSVGHGEGGDSRKRLGLPGAGP
VGIITDLCIMEPEAGTHEFVVTALHPGVTREQVVDATGWAIRFADQVEQTAEPTEVELTA
LRDLEARTAAAHGQAPGEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory