Comparing PfGW456L13_4770 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
60% identity, 89% coverage: 29:298/304 of query aligns to 7:275/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
60% identity, 89% coverage: 29:298/304 of query aligns to 8:276/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
58% identity, 80% coverage: 29:272/304 of query aligns to 5:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
32% identity, 79% coverage: 30:268/304 of query aligns to 6:234/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 76% coverage: 37:268/304 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 76% coverage: 37:268/304 of query aligns to 4:223/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 79% coverage: 29:268/304 of query aligns to 2:228/229 of 5t0wA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
29% identity, 79% coverage: 28:267/304 of query aligns to 1:229/231 of 2v25A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 78% coverage: 29:266/304 of query aligns to 3:229/247 of 2yjpA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
26% identity, 79% coverage: 30:270/304 of query aligns to 3:229/229 of 6svfA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
28% identity, 77% coverage: 37:270/304 of query aligns to 1:224/224 of 4ymxA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
24% identity, 83% coverage: 24:274/304 of query aligns to 39:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
24% identity, 83% coverage: 24:274/304 of query aligns to 38:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
24% identity, 83% coverage: 24:274/304 of query aligns to 38:281/287 of 6h1uA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 76% coverage: 39:268/304 of query aligns to 3:220/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 76% coverage: 39:268/304 of query aligns to 7:224/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 76% coverage: 39:268/304 of query aligns to 13:230/241 of 2q2aA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
28% identity, 68% coverage: 61:268/304 of query aligns to 25:221/226 of 8eyzA
Sites not aligning to the query:
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
26% identity, 78% coverage: 38:273/304 of query aligns to 12:236/243 of 5l9oB
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
26% identity, 78% coverage: 38:273/304 of query aligns to 11:235/241 of 5l9oA
>PfGW456L13_4770 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4770
MRIVPHILGAAIAAALISTPVFAAELTGTLKKIKESGTITLGHRDASIPFSYIADASGKP
VGYSHDIQLKVVEALKKDLDMPNLQVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQ
QVDFSVGIFEIGTRLLSKADSKYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMGMNVI
SAKDHGESFQMLETGRAVAFMMDDALLAGEAAKAKKASDWAVTGTPQSYEIYGCMVRKGD
EPFKKAVDDAIKATYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIAKPTDKAAD
DKKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory