Comparing PfGW456L13_4783 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4783 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
33% identity, 76% coverage: 28:235/273 of query aligns to 29:237/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
33% identity, 76% coverage: 28:235/273 of query aligns to 29:237/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
33% identity, 76% coverage: 28:234/273 of query aligns to 30:237/262 of Q9UYV8
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
33% identity, 76% coverage: 28:235/273 of query aligns to 31:239/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
33% identity, 76% coverage: 28:235/273 of query aligns to 37:245/269 of 6ypaB
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
31% identity, 75% coverage: 49:254/273 of query aligns to 51:268/276 of Q9NQR4
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
30% identity, 93% coverage: 1:254/273 of query aligns to 10:258/263 of 4iztA
Q9RQ17 Aliphatic amidase; Acylamide amidohydrolase; Wide spectrum amidase; EC 3.5.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
29% identity, 84% coverage: 14:243/273 of query aligns to 33:269/348 of Q9RQ17
Sites not aligning to the query:
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
30% identity, 93% coverage: 1:254/273 of query aligns to 2:249/254 of 4izuA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
30% identity, 93% coverage: 1:254/273 of query aligns to 9:257/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
30% identity, 93% coverage: 1:254/273 of query aligns to 9:257/262 of 5ny7A
Sites not aligning to the query:
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
30% identity, 93% coverage: 1:254/273 of query aligns to 9:256/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
30% identity, 93% coverage: 1:254/273 of query aligns to 9:256/261 of 4izsA
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
30% identity, 84% coverage: 14:243/273 of query aligns to 33:269/346 of P11436
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 84% coverage: 28:255/273 of query aligns to 64:297/307 of Q94JV5
Sites not aligning to the query:
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
27% identity, 87% coverage: 18:254/273 of query aligns to 37:278/339 of O25067
4gylA The e142l mutant of the amidase from geobacillus pallidus showing the result of michael addition of acrylamide at the active site cysteine (see paper)
27% identity, 89% coverage: 2:243/273 of query aligns to 28:269/340 of 4gylA
Q03217 Aliphatic nitrilase; EC 3.5.5.7 from Rhodococcus rhodochrous (see paper)
26% identity, 84% coverage: 14:242/273 of query aligns to 21:290/366 of Q03217
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
26% identity, 91% coverage: 3:251/273 of query aligns to 7:280/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
26% identity, 91% coverage: 3:251/273 of query aligns to 11:284/301 of 5h8iC
>PfGW456L13_4783 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4783
MKVELAQLAGRDNDTAYNLERTLAAMAACAADSQLILFPEGHLMGFPSAESVAEVAEPLD
GPSVSAVIAAARQHNISVAIGMAENDNGRFYNTTLLITPEGIALKYRKTHLWASDRGVYE
AGDRYATCLWNGVRVGLLICYDIEFPESARALAQLGAELLIVTNGNMDPYGPTHRTAIMA
RAQENQAFALMVNRVEEGDGGLLFAGGSALVDPLGTLLFEAGREEGQFAVELDLNQLTVA
RQDYRYLDDQRLRLPGEVVEQAGGLRELLIPVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory