SitesBLAST
Comparing PfGW456L13_4831 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4831 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
36% identity, 99% coverage: 5:339/340 of query aligns to 6:331/332 of 8fdbA
- binding 2-deoxy-2-amino glucitol-6-phosphate: R48 (= R47), R48 (= R47), G49 (= G48), S50 (= S49), S51 (= S50), D52 (= D51), Y60 (= Y59), A74 (≠ P73), P75 (≠ M74), S76 (= S75), S96 (= S95), Q97 (= Q96), S98 (= S97), V147 (= V146), A148 (= A147), A149 (= A148), R210 (= R209), Y214 (≠ F213), K223 (= K222), E226 (= E225), S236 (= S235)
- binding magnesium ion: G47 (≠ A46), R48 (= R47), Y60 (= Y59), I95 (≠ F94), S96 (= S95), R210 (= R209), Y214 (≠ F213)
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
36% identity, 99% coverage: 5:339/340 of query aligns to 7:332/333 of 8fdbB
- binding 2-deoxy-2-amino glucitol-6-phosphate: R49 (= R47), R49 (= R47), G50 (= G48), S51 (= S49), S52 (= S50), Y61 (= Y59), A75 (≠ P73), P76 (≠ M74), S77 (= S75), S97 (= S95), Q98 (= Q96), S99 (= S97), R211 (= R209), Y215 (≠ F213), K224 (= K222), E227 (= E225), S237 (= S235)
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
36% identity, 95% coverage: 5:328/340 of query aligns to 5:319/319 of 8eymA
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: R47 (= R47), D51 (= D51), Y59 (= Y59), A71 (≠ S71), A72 (≠ L72), P74 (≠ M74), S75 (= S75), R209 (= R209), S235 (= S235), E238 (= E238)
- binding 2-deoxy-2-amino glucitol-6-phosphate: G48 (= G48), S49 (= S49), S95 (= S95), Q96 (= Q96), A147 (= A147), A148 (= A148), K222 (= K222), E225 (= E225)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
29% identity, 94% coverage: 17:335/340 of query aligns to 275:603/608 of 4amvA
- active site: E481 (= E218), K485 (= K222), E488 (= E225), H504 (= H241), K603 (= K335)
- binding fructose -6-phosphate: G301 (= G48), T302 (≠ S49), S303 (= S50), S347 (= S95), Q348 (= Q96), S349 (= S97), T352 (≠ S100), S401 (≠ A148), K485 (= K222), E488 (= E225)
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
29% identity, 94% coverage: 17:335/340 of query aligns to 275:603/608 of 1jxaA
- active site: E481 (= E218), K485 (= K222), E488 (= E225), H504 (= H241), K603 (= K335)
- binding glucose-6-phosphate: T302 (≠ S49), S303 (= S50), S347 (= S95), Q348 (= Q96), S349 (= S97), T352 (≠ S100), S401 (≠ A148), K485 (= K222), E488 (= E225)
Sites not aligning to the query:
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
29% identity, 94% coverage: 17:335/340 of query aligns to 33:361/366 of 1morA
- active site: E239 (= E218), K243 (= K222), E246 (= E225), H262 (= H241), K361 (= K335)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S49), S105 (= S95), Q106 (= Q96), S107 (= S97), T110 (≠ S100), V157 (= V146), A360 (≠ S334), K361 (= K335)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
29% identity, 94% coverage: 17:335/340 of query aligns to 33:361/366 of 1moqA
- active site: E239 (= E218), K243 (= K222), E246 (= E225), H262 (= H241), K361 (= K335)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S49), S61 (= S50), S105 (= S95), Q106 (= Q96), S107 (= S97), T110 (≠ S100), V157 (= V146), A360 (≠ S334), K361 (= K335)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
29% identity, 94% coverage: 17:335/340 of query aligns to 34:362/367 of 1mosA
- active site: E240 (= E218), K244 (= K222), E247 (= E225), H263 (= H241), K362 (= K335)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (≠ S49), S62 (= S50), S106 (= S95), Q107 (= Q96), S108 (= S97), T111 (≠ S100), K244 (= K222), E247 (= E225)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
29% identity, 94% coverage: 17:335/340 of query aligns to 275:603/608 of 2j6hA
- active site: E481 (= E218), K485 (= K222), E488 (= E225), H504 (= H241), K603 (= K335)
- binding glucose-6-phosphate: T302 (≠ S49), S347 (= S95), Q348 (= Q96), S349 (= S97), T352 (≠ S100), V399 (= V146), S401 (≠ A148), E488 (= E225)
Sites not aligning to the query:
- active site: 1, 26, 27, 74, 98, 99, 248
- binding 5-oxo-l-norleucine: 1, 73, 74, 76, 86, 98, 99, 123
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
29% identity, 93% coverage: 17:331/340 of query aligns to 33:357/357 of 7dnrA
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 99% coverage: 1:335/340 of query aligns to 356:712/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
27% identity, 83% coverage: 46:328/340 of query aligns to 54:352/352 of 2pocB
- active site: E236 (= E218), K240 (= K222), E243 (= E225), H259 (= H241)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (≠ R47), T57 (≠ S49), S58 (= S50), S102 (= S95), Q103 (= Q96), S104 (= S97), T107 (≠ S100), E243 (= E225)
- binding uridine-diphosphate-n-acetylglucosamine: G126 (≠ S119), V128 (= V121), S136 (≠ E129), T139 (≠ C132), C141 (≠ F134), G142 (≠ S135), V143 (≠ L136), H144 (≠ P137)
Sites not aligning to the query:
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
25% identity, 95% coverage: 12:335/340 of query aligns to 29:360/365 of 2zj4A
- active site: E238 (= E218), K242 (= K222), E245 (= E225), H261 (= H241), K360 (= K335)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (≠ S49), S61 (= S50), S105 (= S95), Q106 (= Q96), S107 (= S97), T110 (≠ S100), V156 (= V146), A157 (= A147), K242 (= K222), E245 (= E225)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
25% identity, 95% coverage: 12:335/340 of query aligns to 29:360/365 of 2zj3A
- active site: E238 (= E218), K242 (= K222), E245 (= E225), H261 (= H241), K360 (= K335)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S49), S61 (= S50), S105 (= S95), Q106 (= Q96), S107 (= S97), T110 (≠ S100), V156 (= V146), A359 (≠ S334), K360 (= K335)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
25% identity, 95% coverage: 12:335/340 of query aligns to 327:658/663 of 6r4eA
- active site: E536 (= E218), K540 (= K222), E543 (= E225), H559 (= H241), K658 (= K335)
- binding glucose-6-phosphate: T358 (≠ S49), S359 (= S50), S403 (= S95), Q404 (= Q96), S405 (= S97), T408 (≠ S100), S456 (≠ A148), K540 (= K222), E543 (= E225)
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
25% identity, 95% coverage: 12:335/340 of query aligns to 324:655/660 of 6svmA
- active site: E533 (= E218), K537 (= K222), E540 (= E225), H556 (= H241), K655 (= K335)
- binding glucose-6-phosphate: C353 (≠ R47), T355 (≠ S49), S356 (= S50), S400 (= S95), Q401 (= Q96), S402 (= S97), T405 (≠ S100), S453 (≠ A148), K537 (= K222), E540 (= E225)
- binding magnesium ion: S434 (≠ E129), R435 (≠ A130), T437 (≠ C132)
- binding uridine-diphosphate-n-acetylgalactosamine: G334 (≠ Q22), G424 (≠ S119), T426 (≠ V121), S434 (≠ E129), T437 (≠ C132), C439 (≠ F134), G440 (≠ S135), V441 (≠ L136), H442 (≠ P137)
Sites not aligning to the query:
- active site: 7, 32, 95, 122, 123
- binding glutamic acid: 1, 94, 95, 97, 107, 123, 147
- binding uridine-diphosphate-n-acetylgalactosamine: 289, 322
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
25% identity, 95% coverage: 12:335/340 of query aligns to 363:694/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
25% identity, 95% coverage: 12:333/340 of query aligns to 323:652/652 of 6r4gA
- active site: E532 (= E218), K536 (= K222), E539 (= E225), H555 (= H241)
- binding glucose-6-phosphate: G353 (= G48), T354 (≠ S49), S355 (= S50), S399 (= S95), Q400 (= Q96), S401 (= S97), T404 (≠ S100), S452 (≠ A148), E539 (= E225)
- binding magnesium ion: S433 (≠ E129), R434 (≠ A130), T436 (≠ C132)
- binding uridine-diphosphate-n-acetylglucosamine: G333 (≠ Q22), G423 (≠ S119), T425 (≠ V121), S433 (≠ E129), T436 (≠ C132), C438 (≠ F134), G439 (≠ S135), V440 (≠ L136), H441 (≠ P137)
Sites not aligning to the query:
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
25% identity, 93% coverage: 12:328/340 of query aligns to 28:352/352 of 2v4mA
- active site: E237 (= E218), K241 (= K222), E244 (= E225), H260 (= H241)
- binding fructose -6-phosphate: T59 (≠ S49), S60 (= S50), S104 (= S95), Q105 (= Q96), S106 (= S97), T109 (≠ S100), A156 (= A147), S157 (≠ A148), K241 (= K222), E244 (= E225)
2df8A Crystal structure of the ph0510 protein from pyrococcus horikoshii ot3 in complex with beta-d-fructopyranose-1-phosphate
27% identity, 88% coverage: 39:338/340 of query aligns to 31:324/325 of 2df8A
- active site: E204 (= E218), K208 (= K222), E211 (= E225), H227 (= H241), K321 (= K335)
- binding 1-O-phosphono-beta-D-fructopyranose: S42 (= S50), S87 (= S95), R88 (≠ Q96), S89 (= S97), T92 (≠ S100), V133 (= V146), D320 (≠ S334), K321 (= K335)
Query Sequence
>PfGW456L13_4831 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4831
LTSKMLEEALSSFEAVQAQLQQLDPQMIEIAGRLRRQPPQVAMTVARGSSDHAASYFAYL
TMQLLGIPVASLPMSVVTMQQAPLKVSGQVAFAFSQSGQSPDLVNSLRLLRKRGALSISL
VNAEDSPLEAACEFSLPLCAGTESSVAATKSFIATLSASARLIGHWKEDTELLDACRALP
EGLRDAAQQDWSQAIDALRDCQRLMVIGRGAGFAIAQEAALKFKETSAIQAEAFSSAEVR
HGPMALIGDNYPLLVFAPRGAEQAGLLSLAADMRQRGALVLLAAPDDVLERDLTLTRAEH
PALDPILAIQSFYVMAAGLAVARGMDPDQPRHLSKVTRTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory