Comparing PfGW456L13_4832 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
36% identity, 64% coverage: 279:816/838 of query aligns to 1:549/572 of 2hwgA
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 64% coverage: 278:816/838 of query aligns to 1:550/575 of P08839
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
34% identity, 66% coverage: 279:834/838 of query aligns to 5:569/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
32% identity, 65% coverage: 276:816/838 of query aligns to 1:551/570 of 2wqdA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
42% identity, 35% coverage: 531:827/838 of query aligns to 12:313/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
42% identity, 35% coverage: 531:827/838 of query aligns to 5:306/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
28% identity, 45% coverage: 417:796/838 of query aligns to 416:840/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
27% identity, 45% coverage: 417:796/838 of query aligns to 343:785/797 of 5jvjB
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
27% identity, 45% coverage: 417:796/838 of query aligns to 495:941/953 of Q39735
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
27% identity, 45% coverage: 417:796/838 of query aligns to 416:862/874 of 5jvlA
Sites not aligning to the query:
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
41% identity, 18% coverage: 10:156/838 of query aligns to 501:648/648 of P09323
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 46% coverage: 408:796/838 of query aligns to 496:950/963 of O23404
1vbgA Pyruvate phosphate dikinase from maize (see paper)
27% identity, 46% coverage: 408:796/838 of query aligns to 407:862/874 of 1vbgA
Sites not aligning to the query:
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
27% identity, 44% coverage: 426:796/838 of query aligns to 96:508/520 of 5jvlB
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
26% identity, 46% coverage: 408:796/838 of query aligns to 480:935/947 of P11155
Sites not aligning to the query:
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
38% identity, 17% coverage: 12:153/838 of query aligns to 6:148/150 of 1o2fA
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
38% identity, 17% coverage: 12:153/838 of query aligns to 17:159/161 of 1glcF
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
38% identity, 17% coverage: 12:153/838 of query aligns to 25:167/169 of P69783
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
24% identity, 44% coverage: 428:796/838 of query aligns to 425:859/874 of P22983
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
24% identity, 44% coverage: 428:796/838 of query aligns to 424:858/872 of 1kc7A
Sites not aligning to the query:
>PfGW456L13_4832 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4832
MHNNNKELTLSAPLSGPVLTLAKVPDAVFASGAMGDGIAIDPLNDTLHAPCAGVVVHVAR
TGHAVTLRADNGAELLLHLGLDTVELQGQGFSMLVKEGARVSNGQPLLRYDLDKVAQQCK
SLVSLLILTNSQDFQARPITLKSVKVGEPLLHIIRRQGVGAQADVELAGEEVVGHIRIAH
RGGLHARPAALIRQTAQGFKSKSQLHFAGKSATCDSLIGLMGLAIGEQAEVQVSCQGPDA
EAALQALLTALSTALAEDSHAAAPTTIAQRNRPAEAGVLHGVCAAPGLVGGPLFHLNAIS
LPVDAGHHDPQQQQQVLDAALSQVRSEIERTLVLAKKHKDTAEEAIFAAHLALLEDPALL
DAAIQTVAQGTAATHAWSQAIDVQCEVLQQTGSTLLAERANDLRDLKQRVLRALLGDTWH
YDVPAGAIVAAHELTPSDLLQLSQQGVAGLCMAEGGATSHVAILARGKGLPCMVALGSTL
LDQQQGQPVVLDADGGRLELTPSAERLADVRQLQQQQQQRRAEQQAQAHTPALTTDGLRI
EVAANVASSTEAADALANGADGVGLLRTEFLFVDRHTAPDEQEQHHAYQAVLDAMGDKSV
IIRTIDVGGDKQLDYLPLPAEANPVLGLRGIRLAQARPELLDQQLRALLHLRPLSRCRIL
LPMVTEVDELLHIHQRLDALCGELGLAQRPELGVMIEVPAAALLAEQLAEHADFLSIGTN
DLSQYTLAMDRDHAGLAARVDALHPALLRLIAQTCAGAAQHNRWVGVCGALASDPLATPV
LIGLGVSELSVSPVQVGEIKDRVRHLDASECRRISQGLLKLSSASAVRHACHQHWPLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory