SitesBLAST
Comparing PfGW456L13_4923 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4923 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
43% identity, 91% coverage: 11:276/293 of query aligns to 5:275/306 of 4whxA
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
40% identity, 90% coverage: 11:275/293 of query aligns to 3:269/305 of 2ej0B
- active site: F35 (≠ Y43), G37 (= G45), K158 (= K161), E192 (= E195), L215 (= L218)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R62), Y163 (= Y166), E192 (= E195), G195 (≠ S198), E196 (≠ A199), L215 (= L218), G217 (= G220), I218 (= I221), T219 (= T222), G254 (= G257), T255 (= T258)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
39% identity, 90% coverage: 11:275/293 of query aligns to 3:258/294 of 2ej2A
- active site: F35 (≠ Y43), G37 (= G45), K147 (= K161), E181 (= E195), L204 (= L218)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R62), Y94 (= Y98), Y152 (= Y166), E181 (= E195), G184 (≠ S198), E185 (≠ A199), L204 (= L218), G206 (= G220), I207 (= I221), T208 (= T222), T244 (= T258), A245 (= A259)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
39% identity, 90% coverage: 11:275/293 of query aligns to 3:261/297 of 2ej3A
- active site: F35 (≠ Y43), G37 (= G45), K150 (= K161), E184 (= E195), L207 (= L218)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ S198), G246 (= G257), T247 (= T258), A248 (= A259)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ S198), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), G246 (= G257), T247 (= T258)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
39% identity, 90% coverage: 11:275/293 of query aligns to 3:261/297 of 2eiyA
- active site: F35 (≠ Y43), G37 (= G45), K150 (= K161), E184 (= E195), L207 (= L218)
- binding 4-methyl valeric acid: F35 (≠ Y43), Y94 (= Y98), T247 (= T258), A248 (= A259)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ S198), E188 (≠ A199), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), G246 (= G257), T247 (= T258)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
39% identity, 90% coverage: 11:275/293 of query aligns to 3:261/297 of 1wrvA
- active site: F35 (≠ Y43), G37 (= G45), K150 (= K161), E184 (= E195), L207 (= L218)
- binding pyridoxal-5'-phosphate: R58 (= R62), K150 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ S198), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), T247 (= T258)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
38% identity, 94% coverage: 15:290/293 of query aligns to 9:286/301 of 6thqB
- active site: F37 (≠ Y43), K156 (= K161), E190 (= E195), L214 (= L218)
- binding pyridoxal-5'-phosphate: R60 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), N195 (= N200), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), T254 (= T258)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R62), Y97 (= Y98), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), E194 (≠ A199), N195 (= N200), G216 (= G220), I217 (= I221), T218 (= T222), G253 (= G257), T254 (= T258), A255 (= A259)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
36% identity, 87% coverage: 15:269/293 of query aligns to 5:265/304 of 1iyeA
- active site: F33 (≠ Y43), G35 (= G45), K156 (= K161), A157 (= A162), E190 (= E195), L214 (= L218)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R62), Y92 (= Y98), Y126 (= Y131), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), E194 (≠ A199), N195 (= N200), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), G253 (= G257), T254 (= T258), A255 (= A259)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
36% identity, 87% coverage: 15:269/293 of query aligns to 5:265/304 of 1iydA
- active site: F33 (≠ Y43), G35 (= G45), K156 (= K161), A157 (= A162), E190 (= E195), L214 (= L218)
- binding glutaric acid: Y92 (= Y98), Y126 (= Y131), A255 (= A259)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), E194 (≠ A199), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), T254 (= T258)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
36% identity, 87% coverage: 15:269/293 of query aligns to 5:265/304 of 1i1mA
- active site: K156 (= K161)
- binding 4-methyl valeric acid: Y92 (= Y98), K156 (= K161), T254 (= T258), A255 (= A259)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), E194 (≠ A199), L214 (= L218), G216 (= G220), I217 (= I221), T218 (= T222), G253 (= G257), T254 (= T258)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
36% identity, 87% coverage: 15:269/293 of query aligns to 5:265/304 of 1i1lA
- active site: K156 (= K161)
- binding 2-methylleucine: Y92 (= Y98), K156 (= K161), T254 (= T258), A255 (= A259)
- binding pyridoxal-5'-phosphate: R56 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), G216 (= G220), I217 (= I221), T218 (= T222), T254 (= T258)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
36% identity, 94% coverage: 12:286/293 of query aligns to 2:278/290 of 5e25A
- active site: F33 (≠ Y43), G35 (= G45), K151 (= K161), E184 (= E195), L207 (= L218)
- binding 2-oxoglutaric acid: Y88 (= Y98), K151 (= K161), T247 (= T258), A248 (= A259)
- binding pyridoxal-5'-phosphate: R52 (= R62), K151 (= K161), Y155 (= Y166), E184 (= E195), G187 (≠ S198), D188 (≠ A199), L207 (= L218), G209 (= G220), I210 (= I221), T211 (= T222), G246 (= G257), T247 (= T258)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
33% identity, 94% coverage: 15:288/293 of query aligns to 4:279/290 of 5mr0D
- active site: F32 (≠ Y43), G34 (= G45), K150 (= K161), E183 (= E195), L206 (= L218)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R62), G100 (≠ S111), L101 (≠ T112), K150 (= K161), Y154 (= Y166), E183 (= E195), G186 (≠ S198), D187 (≠ A199), L206 (= L218), I209 (= I221), T210 (= T222), G245 (= G257), T246 (= T258)
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
30% identity, 90% coverage: 16:278/293 of query aligns to 8:277/308 of 6h65C
- active site: F35 (≠ Y43), K158 (= K161), E192 (= E195), L216 (= L218)
- binding pyridoxal-5'-phosphate: R60 (= R62), K158 (= K161), Y163 (= Y166), E192 (= E195), A196 (= A199), L216 (= L218), S218 (≠ G220), V219 (≠ I221), T220 (= T222), G256 (= G257), T257 (= T258)
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
29% identity, 89% coverage: 14:275/293 of query aligns to 17:279/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ Y43), R65 (= R62), N166 (≠ S163), S202 (= S198), T203 (≠ A199), F222 (≠ L218), G224 (= G220), I225 (= I221), T226 (= T222), G261 (= G257), T262 (= T258)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
32% identity, 94% coverage: 15:290/293 of query aligns to 6:290/307 of 6q8eA
- active site: F34 (≠ Y43), K156 (= K161), E190 (= E195), L214 (= L218)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), S194 (≠ A199), C195 (≠ N200), L214 (= L218), S216 (≠ G220), I217 (= I221), T218 (= T222), G254 (= G257), T255 (= T258)
7p3tB Transaminase of gamma-proteobacterium (see paper)
30% identity, 94% coverage: 12:286/293 of query aligns to 3:279/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R62), K153 (= K161), R157 (≠ H165), E186 (= E195), S187 (≠ A196), A188 (≠ T197), A189 (≠ S198), S190 (≠ A199), G210 (= G220), I211 (= I221), T212 (= T222), T248 (= T258)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
31% identity, 94% coverage: 15:290/293 of query aligns to 6:290/309 of 7neaA
- active site: F34 (≠ Y43), K156 (= K161), E190 (= E195), L214 (= L218)
- binding pyridoxal-5'-phosphate: R59 (= R62), K156 (= K161), Y161 (= Y166), E190 (= E195), G193 (≠ S198), S194 (≠ A199), L214 (= L218), S216 (≠ G220), I217 (= I221), T218 (= T222), T255 (= T258)
5fr9A Structure of transaminase ata-117 arrmut11 from arthrobacter sp. Knk168 inhibited with 1-(4-bromophenyl)-2-fluoroethylamine (see paper)
28% identity, 94% coverage: 13:286/293 of query aligns to 26:303/319 of 5fr9A
- active site: Y56 (= Y43), K177 (= K161), E210 (= E195), L232 (= L218)
- binding [4-[3-(4-bromophenyl)-3-oxidanylidene-propyl]-6-methyl-5-oxidanyl-pyridin-3-yl]methyl phosphate: R75 (= R62), K177 (= K161), E210 (= E195), G213 (≠ S198), F214 (≠ A199), L232 (= L218), G234 (= G220), I235 (= I221), T236 (= T222), T272 (= T258)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
25% identity, 92% coverage: 1:271/293 of query aligns to 18:287/321 of 6fteB
- active site: Y58 (= Y43), K179 (= K161), E212 (= E195), L234 (= L218)
- binding pyridoxal-5'-phosphate: R77 (= R62), K179 (= K161), E212 (= E195), F216 (≠ A199), N217 (= N200), L234 (= L218), G236 (= G220), V237 (≠ I221), T238 (= T222), T274 (= T258)
Query Sequence
>PfGW456L13_4923 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4923
MDMSSIPFDQREGVIWLDGEFVEWSRAQLHVLTHGLHYASTVYEGERVYNGRIFKLREHS
ERLYRSAQWMDFAIPYEMAELEAASHELLQRNKVADGYLRPVAWRGSEMISTSARFNRVH
VAIACWQWPSYFDPAARMAGIRLKTASWRRPPPSSSPFEAKASGHYQIATLSKHDAENTG
YHDALMLDWRGHVAEATSANVFFVKGRTLHTPLPDCFLNGITRQTVIELAKALDYQVVER
TILPTELGDFDECFLTGTAAEITPVQSIDEQHYRPGDACRDFIAAYTSTVNAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory