Comparing PfGW456L13_4999 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4999 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
34% identity, 95% coverage: 17:347/350 of query aligns to 8:326/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
34% identity, 95% coverage: 17:347/350 of query aligns to 8:326/329 of 1h1cA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
34% identity, 95% coverage: 17:347/350 of query aligns to 7:325/328 of 1uu0A
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 95% coverage: 17:347/350 of query aligns to 13:331/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
34% identity, 95% coverage: 17:347/350 of query aligns to 14:332/335 of 2f8jA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
29% identity, 99% coverage: 4:350/350 of query aligns to 3:359/360 of 8bj3A
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
32% identity, 94% coverage: 21:350/350 of query aligns to 22:359/364 of 3cq6A
Sites not aligning to the query:
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
32% identity, 94% coverage: 21:350/350 of query aligns to 24:361/366 of 3cq5B
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
30% identity, 97% coverage: 9:347/350 of query aligns to 12:349/353 of 7szpA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
29% identity, 97% coverage: 7:344/350 of query aligns to 7:343/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
29% identity, 97% coverage: 7:344/350 of query aligns to 7:343/353 of 4r2nA
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
27% identity, 97% coverage: 7:344/350 of query aligns to 10:355/369 of 4r8dA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
28% identity, 97% coverage: 9:347/350 of query aligns to 12:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
28% identity, 97% coverage: 9:347/350 of query aligns to 12:349/354 of 1fg3A
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
26% identity, 95% coverage: 1:333/350 of query aligns to 4:347/369 of 4wbtA
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
29% identity, 92% coverage: 27:347/350 of query aligns to 16:335/335 of 1geyA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
26% identity, 92% coverage: 27:347/350 of query aligns to 19:345/354 of 3ly1D
P0DV65 L-serine phosphate decarboxylase; CobD homolog SMUL_1544; SmCobD; L-serine O-phosphate decarboxylase; L-Ser-P decarboxylase; Norcobamide biosynthesis protein SMUL_1544; Threonine phosphate decarboxylase-like enzyme; EC 4.1.1.- from Sulfurospirillum multivorans (strain DM 12446 / JCM 15788 / NBRC 109480) (see paper)
26% identity, 85% coverage: 54:350/350 of query aligns to 76:387/392 of P0DV65
Sites not aligning to the query:
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
30% identity, 76% coverage: 34:300/350 of query aligns to 26:316/380 of 2x5dD
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
26% identity, 79% coverage: 63:339/350 of query aligns to 75:382/402 of P14909
Sites not aligning to the query:
>PfGW456L13_4999 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4999
MSKFWSPFVKNLVPYVPGEQPKLAKLVKLNTNENPYGPSPKALAAMQTELNDNLRLYPDP
NSDLLKNAVARYYGVQSNQVFLGNGSDEVLAHIFHGLLQHDQPLLFPDISYSFYPVYCGL
YGIKFDAVPLDEQFQINPADYARPNGGIIFPNPNAPTGCLLALEAVEQILKASPDSVVVV
DEAYIDFGGETAITLVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALERIKNSFN
SYPLDRMANVGAAAAFEDREYFDKTCRLVIENREKVVAQLEEKGFEVLPSAANFIFARHP
RYDAAGLAAKLREQGVIVRHFKQERIAQFLRISIGTPEQNQALIDGLGDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory