Comparing PfGW456L13_5013 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5013 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
73% identity, 100% coverage: 2:241/241 of query aligns to 1:240/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
67% identity, 100% coverage: 2:241/241 of query aligns to 2:241/241 of 6mbnA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
67% identity, 99% coverage: 2:239/241 of query aligns to 1:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
67% identity, 99% coverage: 2:239/241 of query aligns to 1:238/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
67% identity, 98% coverage: 2:236/241 of query aligns to 1:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
67% identity, 97% coverage: 2:235/241 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
67% identity, 97% coverage: 2:235/241 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
67% identity, 97% coverage: 2:234/241 of query aligns to 1:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
34% identity, 97% coverage: 3:236/241 of query aligns to 6:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 98% coverage: 1:236/241 of query aligns to 2:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 98% coverage: 1:236/241 of query aligns to 2:253/253 of 1g9xB
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
35% identity, 97% coverage: 4:236/241 of query aligns to 3:240/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
33% identity, 97% coverage: 4:236/241 of query aligns to 5:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
33% identity, 97% coverage: 4:236/241 of query aligns to 5:242/263 of 7d08B
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 92% coverage: 4:225/241 of query aligns to 2:216/348 of 3d31A
Sites not aligning to the query:
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
30% identity, 89% coverage: 15:228/241 of query aligns to 15:231/262 of 7chaI
Sites not aligning to the query:
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
27% identity, 99% coverage: 2:239/241 of query aligns to 3:242/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 89% coverage: 11:225/241 of query aligns to 9:224/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 93% coverage: 1:225/241 of query aligns to 1:226/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 93% coverage: 1:225/241 of query aligns to 1:226/242 of 3c41J
>PfGW456L13_5013 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5013
MATLKAQHLAKSYKSRQVVRDVSLSIDSGQIVGLLGPNGAGKTTCFYMIVGLVQADQGRV
LIDDLDVSHQPMHGRAKAGIGYLPQEASIFRKLSVADNIMAILETRKELDKAGRRKELES
LLQEFHISHIRDNLGMSLSGGERRRVEIARALATNPKFILLDEPFAGVDPISVGDIKQII
HHLKAKGIGVLITDHNVRETLDICETAYIVNDGQLIAEGDAETILANDLVKEVYLGHEFR
L
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory