SitesBLAST
Comparing PfGW456L13_5074 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5074 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
32% identity, 89% coverage: 4:282/312 of query aligns to 7:288/315 of 2jg1C
- active site: G256 (= G250), S257 (≠ A251), G258 (= G252), D259 (= D253)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (= S221), G229 (= G223), A230 (≠ V224), G232 (= G226), I246 (≠ P240), I249 (≠ V243), V251 (= V245), V255 (= V249), G256 (= G250), S257 (≠ A251), G258 (= G252), D259 (= D253), T261 (≠ L255), N283 (≠ T277), G286 (≠ A280), M287 (≠ A281)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D14), G42 (= G39), K43 (= K40), R93 (= R90), C95 (≠ N92), L108 (≠ N106), G140 (= G138), S141 (= S139), D259 (= D253)
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
32% identity, 89% coverage: 4:282/312 of query aligns to 10:291/318 of 2jg1A
- active site: G259 (= G250), S260 (≠ A251), G261 (= G252), D262 (= D253)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (= K40), N193 (= N186), S230 (= S221), G232 (= G223), G235 (= G226), I252 (≠ V243), V254 (= V245), G259 (= G250), S260 (≠ A251), G261 (= G252), D262 (= D253), T264 (≠ L255), N286 (≠ T277), G289 (≠ A280), M290 (≠ A281)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
32% identity, 89% coverage: 4:282/312 of query aligns to 6:287/314 of 2jgvB
- active site: G255 (= G250), S256 (≠ A251), G257 (= G252), D258 (= D253)
- binding adenosine-5'-diphosphate: S226 (= S221), A229 (≠ V224), I248 (≠ V243), P253 (≠ T248), S256 (≠ A251), G257 (= G252), N282 (≠ T277), G285 (≠ A280), M286 (≠ A281)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
33% identity, 91% coverage: 4:286/312 of query aligns to 3:288/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (= N186), S224 (= S221), G226 (= G223), I243 (≠ P240), I246 (≠ V243), G253 (= G250), S254 (≠ A251), G255 (= G252), T258 (≠ L255), M280 (≠ A278), G283 (≠ A281), M284 (= M282)
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
29% identity, 91% coverage: 4:286/312 of query aligns to 3:285/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (= N186), S220 (= S221), G222 (= G223), A223 (≠ V224), G225 (= G226), V242 (= V243), G249 (= G250), A250 (= A251), G251 (= G252), D252 (= D253), S279 (≠ A280), V283 (= V284)
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
30% identity, 96% coverage: 1:299/312 of query aligns to 1:290/307 of 3uqeA
- active site: G253 (= G250), A254 (= A251), G255 (= G252), D256 (= D253)
- binding adenosine-5'-triphosphate: K185 (= K184), N187 (= N186), S224 (= S221), G226 (= G223), P227 (≠ V224), G229 (= G226), S248 (≠ V245), A254 (= A251), G255 (= G252), M258 (≠ L255), V280 (≠ F289), G283 (= G292), S284 (≠ D293), T287 (≠ Q296)
- binding pyrophosphate 2-: N187 (= N186), K189 (≠ E188)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
30% identity, 98% coverage: 1:306/312 of query aligns to 1:294/309 of 3uqdB
- active site: G253 (= G250), A254 (= A251), G255 (= G252), D256 (= D253)
- binding adenosine-5'-diphosphate: K185 (= K184), N187 (= N186), S224 (= S221), G226 (= G223), P227 (≠ V224), G229 (= G226), S248 (≠ V245), M258 (≠ L255), V280 (≠ I291), G283 (≠ A295), S284 (≠ Q296)
- binding adenosine-5'-triphosphate: Y23 (≠ D23), K27 (≠ V27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (≠ V27), R29 (= R29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D14), G39 (= G39), N43 (= N43), R90 (= R90), R105 (≠ D104), S139 (= S139), G253 (= G250)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
30% identity, 98% coverage: 1:306/312 of query aligns to 1:294/309 of 3uqdA
- active site: G253 (= G250), A254 (= A251), G255 (= G252), D256 (= D253)
- binding adenosine-5'-triphosphate: K185 (= K184), S224 (= S221), G226 (= G223), P227 (≠ V224), G229 (= G226), T251 (= T248), G255 (= G252), M258 (≠ L255), V280 (≠ I291), G283 (≠ A295), S284 (≠ Q296), T287 (≠ Q299)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), G38 (≠ A38), G39 (= G39), N43 (= N43), R90 (= R90), S139 (= S139), D256 (= D253)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (≠ V27), R29 (= R29)
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
30% identity, 98% coverage: 1:306/312 of query aligns to 1:294/309 of 3n1cA
- active site: G253 (= G250), A254 (= A251), G255 (= G252), D256 (= D253)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), K27 (≠ V27), R29 (= R29), G39 (= G39), N43 (= N43), R90 (= R90), G138 (= G138), S139 (= S139), D256 (= D253)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 98% coverage: 1:306/312 of query aligns to 1:294/309 of P06999
- K27 (≠ V27) binding ; binding
- KPN 185:187 (= KPN 184:186) binding in other chain
- NQK 187:189 (≠ NTE 186:188) binding in other chain
- E190 (= E189) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ SHGVDG 221:226) binding in other chain
- S248 (≠ V245) binding in other chain
- S250 (= S247) binding
- V252 (= V249) binding
- V280 (≠ I291) binding in other chain
- S284 (≠ Q296) binding in other chain
- A286 (= A298) binding
- N289 (≠ E301) binding
- G291 (= G303) binding
- R293 (= R305) binding
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
30% identity, 91% coverage: 1:283/312 of query aligns to 1:286/304 of 3cqdA
- active site: G253 (= G250), A254 (= A251), G255 (= G252), D256 (= D253)
- binding adenosine-5'-triphosphate: Y23 (≠ D23), G26 (≠ Q26), K27 (≠ V27), K185 (= K184), N187 (= N186), N187 (= N186), K189 (≠ E188), S224 (= S221), G226 (= G223), P227 (≠ V224), G229 (= G226), S248 (≠ V245), T251 (= T248), A254 (= A251), G255 (= G252), M258 (≠ L255), V280 (≠ T277), G283 (≠ A280), S284 (≠ A281)
Sites not aligning to the query:
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
28% identity, 91% coverage: 4:286/312 of query aligns to 3:278/298 of 3julA
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
28% identity, 84% coverage: 4:265/312 of query aligns to 3:274/320 of 2ajrA
Sites not aligning to the query:
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 84% coverage: 3:263/312 of query aligns to 13:275/339 of P9WID3
Sites not aligning to the query:
- 283 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 80% coverage: 39:288/312 of query aligns to 31:292/319 of Q8ZKR2
- G31 (= G39) binding
- Y101 (≠ A119) binding
- R162 (vs. gap) binding
- A180 (vs. gap) binding
- A181 (vs. gap) binding
- A183 (≠ G195) binding
- G213 (= G214) binding
- D246 (≠ S247) binding
- T248 (≠ V249) binding
- D252 (= D253) binding
- A287 (= A283) binding
- A290 (≠ Q286) binding
- G292 (= G288) binding
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
25% identity, 80% coverage: 39:288/312 of query aligns to 27:281/299 of 1tz3A
- active site: F88 (≠ D99), G238 (= G250), A239 (= A251), G240 (= G252), D241 (= D253)
- binding 5-aminoimidazole ribonucleoside: G27 (= G39), L83 (≠ K94), F88 (≠ D99), Y90 (≠ R101), R151 (vs. gap), M154 (vs. gap), D241 (= D253)
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
25% identity, 80% coverage: 39:288/312 of query aligns to 27:281/297 of 1tz6A
- active site: F88 (≠ D99), G238 (= G250), A239 (= A251), G240 (= G252), D241 (= D253)
- binding phosphomethylphosphonic acid adenylate ester: N149 (vs. gap), K176 (≠ S199), E181 (≠ A204), S209 (= S221), G211 (= G223), A212 (≠ V224), G214 (= G226), A239 (= A251), G240 (= G252), F243 (≠ L255), N270 (≠ T277), G273 (≠ A280), A274 (= A281)
- binding 5-aminoimidazole ribonucleoside: G27 (= G39), F88 (≠ D99), Y90 (≠ R101), R151 (vs. gap), M154 (vs. gap), D241 (= D253)
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
27% identity, 91% coverage: 1:284/312 of query aligns to 1:290/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N186), K225 (≠ S221), G227 (= G223), I246 (≠ P240), A248 (≠ R242), A257 (= A251), G258 (= G252), F261 (≠ L255), A286 (= A280), S287 (≠ A281)
- binding alpha-D-ribofuranose: N12 (≠ A12), D14 (= D14), G40 (= G39), K41 (= K40), N44 (= N43), E144 (≠ S139), D259 (= D253)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 87% coverage: 14:284/312 of query aligns to 80:356/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
7w93A Crystal structure of e.Coli pseudouridine kinase psuk complexed with n1-methyl-pseudouridine (see paper)
26% identity, 79% coverage: 39:285/312 of query aligns to 40:287/307 of 7w93A
- binding 5-[(2S,3R,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]-1-methyl-pyrimidine-2,4-dione: G40 (= G39), V41 (≠ K40), N44 (= N43), Y96 (≠ N92), M113 (≠ I105), N142 (≠ G143), K169 (≠ E170), D255 (= D253)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_5074 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5074
MARILTLTLNPALDLTVQLPRLDAGQVNRSDVMHTHAAGKGVNVAQVLADLGHQLTVSGF
LGEDNLQAFETLFAKRGFVDAFIRVPGETRSNIKLAESDGRITDINGPGPQVSEAAQQAL
MDRLEQIAPGHDAVVVAGSLPLGVSAQWLQALILRLKNLGLNVALDTSGEALRAALKAGP
WLIKPNTEELAEVLGEVVSVSAQALAAERLHAQGIEHVVISHGVDGVNWFSVGSALHATP
PRVNVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIGDAAQLAQL
EQGVRVRPLTEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory