SitesBLAST
Comparing PfGW456L13_5129 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
29% identity, 97% coverage: 5:519/531 of query aligns to 2:546/557 of 2rgoA
- binding flavin-adenine dinucleotide: G25 (= G28), I28 (= I31), T29 (≠ S32), E48 (= E51), M49 (≠ Q52), Q50 (≠ R53), T56 (= T59), S57 (= S60), A197 (≠ V193), S232 (≠ T228), G233 (= G229), W235 (= W231), G257 (= G249), G344 (= G336), L345 (≠ V337), Y357 (≠ H348), K382 (= K374), I383 (≠ L375), T384 (= T376)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 99% coverage: 2:529/531 of query aligns to 54:621/629 of Q9SS48
- S86 (≠ A34) mutation to F: In spd6-2; loss of 90% of activity.
- E546 (≠ W454) mutation to G: In spd6-1; loss of 90% of activity.
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 90% coverage: 44:519/531 of query aligns to 39:517/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E51), M47 (≠ Q52), Q48 (≠ R53), T54 (= T59), S55 (= S60), S58 (= S63), T59 (≠ S64), A193 (≠ V193), S227 (≠ T228), G228 (= G229), W230 (= W231), L338 (≠ V337), R339 (= R338), Y350 (≠ K351), K374 (= K374), I375 (≠ L375), T376 (= T376)
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
29% identity, 89% coverage: 5:477/531 of query aligns to 2:442/496 of 3da1A
- binding flavin-adenine dinucleotide: I24 (= I27), G27 (= G30), I28 (= I31), T29 (≠ S32), E48 (= E51), M49 (≠ Q52), G55 (= G58), S57 (= S60), S60 (= S63), T61 (≠ S64), L63 (≠ M66), H65 (= H68), V151 (= V193), G187 (= G229), W189 (= W231), L193 (= L235), G210 (= G249), T250 (= T289), G296 (= G336), R298 (= R338), G319 (= G373), K320 (= K374), L321 (= L375)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
34% identity, 87% coverage: 20:483/531 of query aligns to 2:477/501 of 2qcuB
- binding flavin-adenine dinucleotide: I9 (= I27), G12 (= G30), I13 (= I31), N14 (≠ S32), E33 (= E51), A34 (≠ Q52), C39 (≠ W57), T41 (= T59), S42 (= S60), S45 (= S63), S46 (= S64), L48 (≠ M66), H50 (= H68), A172 (≠ V193), T206 (= T228), W209 (= W231), G231 (= G249), R317 (= R338), G353 (= G373), K354 (= K374), L355 (= L375), T356 (= T376)
- binding phosphate ion: R54 (= R72), Y55 (= Y73), R317 (= R338), R332 (= R357)
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
34% identity, 87% coverage: 20:483/531 of query aligns to 2:477/495 of 2r46A
- binding flavin-adenine dinucleotide: I9 (= I27), G12 (= G30), I13 (= I31), N14 (≠ S32), L32 (= L50), E33 (= E51), A34 (≠ Q52), T41 (= T59), S42 (= S60), A44 (≠ R62), S45 (= S63), S46 (= S64), L48 (≠ M66), A172 (≠ V193), T206 (= T228), G231 (= G249), R317 (= R338), G353 (= G373), K354 (= K374), L355 (= L375), T356 (= T376)
- binding phosphoenolpyruvate: R54 (= R72), Y55 (= Y73), R254 (= R274), T270 (= T289), D272 (= D291), R317 (= R338), R332 (= R357)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ G178), V455 (≠ C461), D456 (= D462), H457 (≠ G463), W459 (≠ M465)
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
34% identity, 87% coverage: 20:483/531 of query aligns to 2:477/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R72), Y55 (= Y73), R254 (= R274), I255 (≠ P275), T270 (= T289), R317 (= R338), R332 (= R357)
- binding flavin-adenine dinucleotide: I9 (= I27), G12 (= G30), I13 (= I31), N14 (≠ S32), E33 (= E51), A34 (≠ Q52), C39 (≠ W57), A40 (≠ G58), T41 (= T59), S42 (= S60), A44 (≠ R62), S45 (= S63), S46 (= S64), L48 (≠ M66), A172 (≠ V193), T206 (= T228), G207 (= G229), W209 (= W231), G231 (= G249), R317 (= R338), G353 (= G373), K354 (= K374), L355 (= L375), T356 (= T376)
- binding phosphate ion: Q212 (≠ R234), G277 (= G296), P279 (≠ D299), V310 (≠ L331), Y398 (vs. gap), R401 (vs. gap), R405 (vs. gap), R462 (≠ H468), D464 (= D470), W468 (≠ L474)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ G178), V160 (≠ R181), V455 (≠ C461), D456 (= D462), H457 (≠ G463), W459 (≠ M465)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
29% identity, 44% coverage: 23:256/531 of query aligns to 4:237/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I27), G9 (= G28), G11 (= G30), V12 (≠ I31), V13 (≠ S32), E32 (= E51), A33 (≠ Q52), T41 (= T59), S42 (= S60), R44 (= R62), N45 (≠ S63), S46 (= S64), V48 (≠ M66), H50 (= H68), P170 (≠ V191), L171 (≠ R192), A203 (≠ T228)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_5129 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_5129
MSLDWNAAWRQRVLPTLADETWDLIVIGGGISGAGILREAARRGWRCLLLEQRDFAWGTS
SRSSKMVHGGLRYIAKGQWRLTRDSVRERQRLLDEAPGLVEPMSFMMPHYRGGFPGPRVL
GGLLSIYDALAGRRSHHFHDAQQLRYLAPGVKEDDLLGGTCFVDALTDDARLVMRVLGEA
RADGAVVLNGVRVQQLLREEGRVCGVQVEDCEGGGLLTLRCGALAVATGAWAERLRLPDA
PRQLRPLRGSHLLLPGWRLPVAQAFTFLHERDRRPVFVFPWEGATVVGTTDLDHHGDLDQ
SASISFDELDYLLAACSQQFPQAEVVAADVLSTWSGVRPVVGSAAGEHQDKPSNETREHV
LWQEPGCVTLAGGKLTTFRPQAIEVLKACATMLDRPFVDDATPVFAAVPPLAIPGLSANR
WRRLAGRHGRDLPRLAQLIAELGHDTVGGTDTLWAELAVACDGEMVLHLDDLLLRRTRLG
LLLPRGGEDYFAAIRQLCQPRLGWDDEHWQQELQRYRALWQRHHGLPDAAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory