SitesBLAST
Comparing PfGW456L13_52 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_52 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vqdA Crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp (see paper)
88% identity, 98% coverage: 5:447/452 of query aligns to 2:444/447 of 2vqdA
- active site: K116 (= K119), K159 (= K162), P196 (= P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding phosphomethylphosphonic acid adenosyl ester: K116 (= K119), I157 (= I160), K159 (= K162), G164 (= G167), G166 (= G169), F203 (= F206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281), E288 (= E291), I437 (= I440)
- binding magnesium ion: E276 (= E279), E288 (= E291)
4mv4A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2 (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:441/442 of 4mv4A
- active site: K116 (= K119), K159 (= K162), D193 (≠ P199), H206 (= H212), R232 (= R238), T271 (= T277), E273 (= E279), E285 (= E291), N287 (= N293), R289 (= R295), E293 (= E299), R335 (= R341)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K162), G164 (= G167), M166 (= M172), E198 (= E204), Y200 (≠ F206), L201 (= L207), H233 (= H239), L275 (= L281), E285 (= E291)
- binding magnesium ion: E273 (= E279), E285 (= E291)
6oi8A Crystal structure of haemophilus influenzae biotin carboxylase complexed with 7-((1r,5s,6s)-6-amino-3-azabicyclo[3.1.0]hexan-3-yl)- 6-(2-chloro-6-(pyridin-3-yl)phenyl)pyrido[2,3-d]pyrimidin-2-amine (see paper)
69% identity, 98% coverage: 5:447/452 of query aligns to 2:439/440 of 6oi8A
- active site: K116 (= K119), K159 (= K162), D191 (≠ P199), H204 (= H212), R230 (= R238), T269 (= T277), E271 (= E279), E283 (= E291), N285 (= N293), R287 (= R295), E291 (= E299), R333 (= R341)
- binding 7-[(1R,5S,6s)-6-amino-3-azabicyclo[3.1.0]hexan-3-yl]-6-[2-chloro-6-(pyridin-3-yl)phenyl]pyrido[2,3-d]pyrimidin-2-amine: I157 (= I160), K159 (= K162), M164 (= M172), E196 (= E204), Y198 (≠ F206), L199 (= L207), H204 (= H212), Q228 (= Q236), E271 (= E279), L273 (= L281), E283 (= E291), I432 (= I440)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
69% identity, 98% coverage: 5:447/452 of query aligns to 2:442/444 of 2vr1A
- active site: K116 (= K119), K159 (= K162), D194 (≠ P199), H207 (= H212), R233 (= R238), T272 (= T277), E274 (= E279), E286 (= E291), N288 (= N293), R290 (= R295), E294 (= E299), R336 (= R341)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K162), R165 (= R170), M167 (= M172), Y201 (≠ F206), L202 (= L207), E274 (= E279), L276 (= L281), E286 (= E291), N288 (= N293), I435 (= I440)
4mv3A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and bicarbonate (see paper)
69% identity, 98% coverage: 5:447/452 of query aligns to 2:438/439 of 4mv3A
- active site: K116 (= K119), K159 (= K162), D190 (≠ P199), H203 (= H212), R229 (= R238), T268 (= T277), E270 (= E279), E282 (= E291), N284 (= N293), R286 (= R295), E290 (= E299), R332 (= R341)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K162), M163 (= M172), E195 (= E204), Y197 (≠ F206), L198 (= L207), E270 (= E279), L272 (= L281), E282 (= E291)
- binding bicarbonate ion: R286 (= R295), Q288 (= Q297), V289 (= V298)
P43873 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/448 of P43873
- K116 (= K119) binding
- K159 (= K162) binding
- EKYL 201:204 (≠ EKFL 204:207) binding
- E276 (= E279) binding ; binding
- E288 (= E291) binding ; binding
- N290 (= N293) binding
6ojhA Crystal structure of haemophilus influenzae biotin carboxylase complexed with (r)-7-(3-aminopyrrolidin-1-yl)-6-(naphthalen-1-yl) pyrido[2,3-d]pyrimidin-2-amine
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/445 of 6ojhA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding calcium ion: E276 (= E279), E288 (= E291), N290 (= N293)
- binding 7-[(3R)-3-aminopyrrolidin-1-yl]-6-(naphthalen-1-yl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K162), M169 (= M172), E201 (= E204), Y203 (≠ F206), L204 (= L207), H236 (= H239), L278 (= L281), E288 (= E291), I437 (= I440)
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/449 of P24182
- R19 (= R22) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (= E26) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K119) binding
- K159 (= K162) binding
- GG 165:166 (= GG 168:169) binding
- EKYL 201:204 (≠ EKFL 204:207) binding
- H209 (= H212) binding
- H236 (= H239) binding
- K238 (= K241) binding
- E276 (= E279) binding ; binding
- E288 (= E291) binding ; binding
- R292 (= R295) active site; binding
- V295 (= V298) binding
- E296 (= E299) mutation to A: Severe reduction in catalytic activity.
- R338 (= R341) binding ; binding ; mutation to A: Severe reduction in catalytic activity.
- F363 (≠ N366) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R369) mutation to E: Loss of homodimerization. No effect on ATP binding.
3rupA Crystal structure of e.Coli biotin carboxylase in complex with two adp and two ca ions (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/444 of 3rupA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding adenosine-5'-diphosphate: Y82 (= Y85), G83 (= G86), K116 (= K119), K159 (= K162), G164 (= G167), G164 (= G167), G165 (= G168), G166 (= G169), R167 (= R170), M169 (= M172), F193 (= F196), E201 (= E204), K202 (= K205), Y203 (≠ F206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), K238 (= K241), L278 (= L281), E288 (= E291), R292 (= R295), V295 (= V298), E296 (= E299), R338 (= R341), D382 (= D385), I437 (= I440)
- binding calcium ion: E87 (= E90), E276 (= E279), E288 (= E291), E288 (= E291), N290 (= N293)
3g8cA Crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/444 of 3g8cA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding adenosine-5'-diphosphate: I157 (= I160), K159 (= K162), G164 (= G167), M169 (= M172), E201 (= E204), K202 (= K205), Y203 (≠ F206), L204 (= L207), Q233 (= Q236), H236 (= H239), L278 (= L281), E288 (= E291), I437 (= I440)
- binding bicarbonate ion: K238 (= K241), R292 (= R295), Q294 (= Q297), V295 (= V298), E296 (= E299)
- binding biotin: Y82 (= Y85), F84 (= F87), R292 (= R295), V295 (= V298), R338 (= R341), D382 (= D385)
- binding magnesium ion: E276 (= E279), E288 (= E291)
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/445 of 3jziA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K119), K159 (= K162), A160 (= A163), G164 (= G167), G165 (= G168), M169 (= M172), Y199 (= Y202), E201 (= E204), K202 (= K205), Y203 (≠ F206), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281), I287 (= I290), E288 (= E291)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/445 of 2w6oA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K162), K202 (= K205), Y203 (≠ F206), L204 (= L207), L278 (= L281), I437 (= I440)
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/445 of 2w6nA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (= I160), K159 (= K162), M169 (= M172), E201 (= E204), K202 (= K205), Y203 (≠ F206), L278 (= L281)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/445 of 2v59A
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K162), Y203 (≠ F206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281), I437 (= I440)
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/446 of 6oi9A
- active site: E276 (= E279), E288 (= E291), N290 (= N293), E296 (= E299), R338 (= R341)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K162), M169 (= M172), E201 (= E204), Y203 (≠ F206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), E276 (= E279), L278 (= L281), E288 (= E291), I437 (= I440)
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/446 of 2w71A
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K162), Y203 (≠ F206), L204 (= L207), H209 (= H212), Q233 (= Q236), H236 (= H239), L278 (= L281), I437 (= I440)
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/446 of 2w70A
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (= I160), K159 (= K162), G166 (= G169), M169 (= M172), E201 (= E204), Y203 (≠ F206), L204 (= L207), L278 (= L281)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/446 of 2w6zA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K162), Y203 (≠ F206), L204 (= L207), L278 (= L281)
2w6qA Crystal structure of biotin carboxylase from e. Coli in complex with the triazine-2,4-diamine fragment (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/446 of 2w6qA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 6-(2-phenoxyethoxy)-1,3,5-triazine-2,4-diamine: I157 (= I160), K159 (= K162), E201 (= E204), K202 (= K205), Y203 (≠ F206), L204 (= L207), H236 (= H239), L278 (= L281)
2w6pA Crystal structure of biotin carboxylase from e. Coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine (see paper)
70% identity, 98% coverage: 5:447/452 of query aligns to 2:444/446 of 2w6pA
- active site: K116 (= K119), K159 (= K162), D196 (≠ P199), H209 (= H212), R235 (= R238), T274 (= T277), E276 (= E279), E288 (= E291), N290 (= N293), R292 (= R295), E296 (= E299), R338 (= R341)
- binding 5-methyl-6-phenylquinazoline-2,4-diamine: K159 (= K162), Y203 (≠ F206), L204 (= L207), Q233 (= Q236), H236 (= H239), L278 (= L281), I437 (= I440)
Query Sequence
>PfGW456L13_52 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_52
MTAKLEKVLIANRGEIALRILRACKEMGIKTVAVYSKADKELMHLGLADESVCIGPASAA
HSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVEKSGFAFIGPKAETIRLMGDKV
SAKHAMIAAGVPTVPGSDGPLPEDEETALRIGREVGYPVIIKAAGGGGGRGMRVVHKEED
LIASAKLTRSEAGAAFGNPMVYLEKFLTNPRHVEVQVLSDGQGQAIHLGDRDCSLQRRHQ
KVLEEAPAPGIDENAREEVLARCVRACIDIGYRGAGTFEFLYENGRFYFIEMNTRVQVEH
PVSEMVTGIDIVKEMLSIAAGNKLSFTQDDVVIRGHALECRINAEDPKTFMPSPGTVKHF
HAPGGNGVRVDSHLYSGYAVPPNYDSLIGKLITYGATRDEAMARMRNALDEIVVDGIKTN
IPLHRDLTRDEGFCKGGVNIHYLEHKLAGEKH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory