SitesBLAST
Comparing PfGW456L13_578 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_578 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 12:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A277), S275 (= S278), S276 (= S279), T313 (≠ S315), G353 (= G355), V354 (= V356), A357 (≠ V359), G358 (≠ S360), D394 (= D389), R397 (= R392), T398 (= T393)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K197), G198 (≠ M201), Y202 (= Y205)
- binding sodium ion: Y87 (≠ F88), T90 (≠ V91), S91 (≠ T92), S276 (= S279), G305 (= G307), A306 (≠ Y308), T307 (≠ S309), N309 (= N311), N309 (= N311), M310 (≠ L312), D311 (= D313), S348 (= S350), I349 (≠ K351), G350 (= G352), T351 (≠ I353), N401 (= N396), V402 (= V397), D405 (≠ N400)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 12:423/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 9:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K197), G195 (≠ M201), R282 (= R285)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A277), S272 (= S278), S273 (= S279), M307 (≠ L312), T310 (≠ S315), G353 (= G358), A354 (≠ V359), R394 (= R392), T395 (= T393)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
38% identity, 92% coverage: 10:418/443 of query aligns to 10:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
37% identity, 92% coverage: 10:418/443 of query aligns to 5:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A277), S265 (= S279), M299 (≠ L312), T302 (≠ S315), T340 (≠ I353), G342 (= G355), V343 (= V356), G347 (≠ S360), D383 (= D389), R386 (= R392), T387 (= T393), N390 (= N396)
- binding decyl-beta-d-maltopyranoside: H23 (= H28), V212 (≠ L226), A216 (= A230)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
36% identity, 91% coverage: 10:412/443 of query aligns to 14:417/425 of O59010
- S65 (= S63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A277) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 277:279) binding
- M311 (≠ L312) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S315) binding
- V355 (= V356) binding
- D394 (= D389) binding
- M395 (= M390) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R392) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N396) binding
- D405 (≠ N400) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
36% identity, 91% coverage: 10:412/443 of query aligns to 14:417/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ A44), F46 (≠ A44), P75 (≠ D73), L91 (≠ I90), F95 (≠ I94), L130 (≠ F138), I133 (≠ T141), I159 (≠ V167), Y167 (≠ S175), K196 (= K197), G200 (≠ M201), I207 (= I208), F210 (= F211), L250 (≠ I251), I262 (≠ M263), M269 (≠ L270), T334 (≠ S335), V335 (≠ I336), G336 (≠ S337), T340 (≠ L341), L343 (= L344), M399 (≠ A394)
- binding aspartic acid: S277 (= S278), S278 (= S279), T314 (≠ S315), G354 (= G355), A358 (≠ V359), G359 (≠ S360), D394 (= D389), R397 (= R392), T398 (= T393)
- binding sodium ion: Y89 (≠ F88), T92 (≠ V91), S93 (≠ T92), G306 (= G307), T308 (≠ S309), N310 (= N311), N310 (= N311), M311 (≠ L312), D312 (= D313), S349 (= S350), I350 (≠ K351), T352 (≠ I353), N401 (= N396), V402 (= V397), D405 (≠ N400)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
36% identity, 91% coverage: 10:411/443 of query aligns to 5:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
35% identity, 91% coverage: 10:412/443 of query aligns to 6:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
36% identity, 91% coverage: 10:411/443 of query aligns to 11:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ I85), I157 (≠ L168), Y164 (≠ S175), K193 (= K197), T305 (≠ S309), I306 (≠ F310), I347 (≠ K351)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I12), M199 (= M203), S275 (= S279), T311 (≠ S315), G356 (≠ S360), L384 (≠ A382), D391 (= D389), R394 (= R392)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
35% identity, 91% coverage: 10:411/443 of query aligns to 6:408/408 of 6bauA
- binding cysteine: S270 (= S279), M303 (≠ L312), T306 (≠ S315), A345 (= A354), G346 (= G355), V347 (= V356), G351 (≠ S360), D386 (= D389), C389 (≠ R392), T390 (= T393), N393 (= N396)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
34% identity, 91% coverage: 10:411/443 of query aligns to 6:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 84% coverage: 45:418/443 of query aligns to 57:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L77), G89 (= G78), G92 (= G81), A95 (≠ T84), V96 (≠ I85), Y99 (≠ F88), M163 (≠ V167), F167 (≠ L171), F293 (= F302), V297 (≠ T306)
- binding aspartic acid: S268 (= S278), S269 (= S279), T306 (≠ S315), G346 (= G355), I347 (≠ V356), A350 (≠ V359), G351 (≠ S360), D380 (= D389), R383 (= R392), T384 (= T393)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 94% coverage: 16:433/443 of query aligns to 29:501/503 of Q10901
- N177 (≠ I146) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ R156) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 87% coverage: 15:401/443 of query aligns to 18:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S278), S281 (= S279), T318 (≠ S315), G363 (≠ S360), M367 (≠ L364), V385 (≠ A382), D388 (= D385), R395 (= R392), T396 (= T393)
- binding dodecyl beta-D-glucopyranoside: V19 (≠ L16), I20 (≠ V17), W389 (≠ R386)
- binding cholesterol hemisuccinate: R80 (= R79), R84 (≠ K83), I95 (= I94), I252 (≠ F255)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 87% coverage: 15:401/443 of query aligns to 17:405/425 of 7xr4A
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
30% identity, 84% coverage: 45:417/443 of query aligns to 49:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I68), S80 (≠ L77), G81 (= G78), G84 (= G81), Y91 (≠ F88), M156 (≠ V167), F160 (≠ L171), F286 (= F302), V290 (≠ T306)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V60), I148 (≠ M159), S262 (= S279), S263 (≠ E280), A292 (≠ Y308), T293 (≠ S309), M296 (≠ L312), T299 (≠ S315), G329 (= G352), A336 (≠ V359), G337 (≠ S360), D366 (= D389), R369 (= R392), N373 (= N396)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
28% identity, 88% coverage: 12:403/443 of query aligns to 58:490/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 93% coverage: 15:425/443 of query aligns to 53:533/573 of P31596
- K298 (≠ S225) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ R253) mutation H->N,T,K,R: No transporter activity.
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
30% identity, 87% coverage: 15:401/443 of query aligns to 10:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S63), L58 (= L64), L65 (≠ V71), V339 (≠ K351), G340 (= G352), S343 (≠ G355), I344 (≠ V356)
- binding cholesterol: W188 (≠ N204), I227 (≠ F245), F250 (≠ L262), W257 (≠ L270), M379 (≠ A391), S382 (≠ A394)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S279), M300 (≠ L312), T303 (≠ S315), Y306 (= Y318), G348 (≠ S360), L349 (≠ F361), M352 (≠ L364), I366 (≠ L378), L369 (≠ I381), V370 (≠ A382), D373 (= D385), D377 (= D389), R380 (= R392), T381 (= T393), N384 (= N396)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_578 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_578
MKKAKLSLAWQILIGLVLGIAIGALLNHFSAEKAWWISNVLQPAGDIFIRLIKMIVIPIV
ISSLIVGIAGVGDAKKLGRIGFKTIIYFEIVTTIAIVVGLLLANLFHPGAGIDMSTLGTV
DISKYQATAAEVQHEHAFIETILNLIPSNIFAAMVRGEMLPIIFFSVLFGLGLSSLQADL
REPLVKMFQGVSESMFKVTHMIMNYAPIGVFALIAVTVANFGFASLIPLAKLVILVYVAI
AFFAFVILGLIARLFGFSVIKLMRIFKDELVLAYSTASSETVLPRVIEKMEAYGAPKAIC
SFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSISQQLLLVLTLMVTSKGIAGVPGVS
FVVLLATLGSVGIPLEGLAFIAGVDRVMDMARTALNVIGNALAVLVIARWEGMYDDAKGQ
RYWNSLPHWRSKEKLPAGETSSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory