Comparing PfGW456L13_78 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_78 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 97% coverage: 2:254/262 of query aligns to 10:260/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 80% coverage: 25:233/262 of query aligns to 17:227/240 of 4ymuJ
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
31% identity, 93% coverage: 4:246/262 of query aligns to 2:255/276 of Q5M243
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 79% coverage: 25:231/262 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 79% coverage: 25:231/262 of query aligns to 22:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 79% coverage: 25:231/262 of query aligns to 22:231/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 79% coverage: 25:231/262 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 79% coverage: 25:231/262 of query aligns to 18:225/241 of 4u00A
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
31% identity, 97% coverage: 4:257/262 of query aligns to 3:250/280 of Q5M244
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 79% coverage: 25:231/262 of query aligns to 21:229/280 of 5x40A
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
34% identity, 79% coverage: 23:230/262 of query aligns to 14:216/348 of 3d31A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 78% coverage: 27:231/262 of query aligns to 44:252/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 78% coverage: 27:231/262 of query aligns to 44:252/382 of 7aheC
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
34% identity, 77% coverage: 27:229/262 of query aligns to 20:226/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
34% identity, 77% coverage: 27:229/262 of query aligns to 22:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
34% identity, 77% coverage: 27:229/262 of query aligns to 22:228/263 of 7d08B
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 81% coverage: 27:239/262 of query aligns to 20:233/240 of 6mjpA
7ahdC Opua (e190q) occluded (see paper)
31% identity, 78% coverage: 27:231/262 of query aligns to 44:252/260 of 7ahdC
Sites not aligning to the query:
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
34% identity, 78% coverage: 18:221/262 of query aligns to 7:218/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
34% identity, 78% coverage: 18:221/262 of query aligns to 7:218/227 of 8igqA
>PfGW456L13_78 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_78
MTSLNLTNLTWSPLGHGHCHHQFQLRDASLHVAAGEFVGLIGPNGSGKTSLLRCAWRFNQ
PESGEVRLDHQNVWKHSSRWCAQRIAVVLQEFPDAFGLTVEEVVAMGRTPHKGLFDGDTL
EDRDLVNQALESVGLKGFEDHGFATLSGGEKQRVILARALAQQPQLLILDEPTNHLDPRY
QLELLKLVKRLNIGTLASIHDLNLAAAFCDRLYVINHGRIVASGTPKEVLTAALLRNVFG
VQALIDEHPLHGYPRITWITQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory