SitesBLAST
Comparing PfGW456L13_812 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_812 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
24% identity, 96% coverage: 2:418/436 of query aligns to 25:400/824 of Q8GAI3
- W66 (= W57) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ A58) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
26% identity, 94% coverage: 3:411/436 of query aligns to 1:361/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G9), G9 (= G11), I10 (≠ V12), D30 (= D32), N32 (vs. gap), H33 (≠ Q34), K36 (≠ A37), A37 (= A38), T38 (≠ S42), A40 (= A44), G41 (≠ N45), A42 (= A46), G43 (= G47), V44 (≠ Q48), Y174 (≠ I226), A203 (≠ L255), W206 (≠ Y258), I210 (≠ L262), Y250 (= Y300), G305 (= G356), R307 (= R358), G333 (= G383), A334 (≠ T384), S335 (≠ L385), G336 (= G386), L337 (≠ W387), T338 (= T388)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 69% coverage: 122:422/436 of query aligns to 78:374/377 of Q5L2C2
- V180 (vs. gap) binding
- R309 (= R358) binding
- 334:340 (vs. 382:388, 29% identical) binding
- R336 (≠ T384) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 68% coverage: 122:418/436 of query aligns to 77:368/368 of 4yshB
- active site: I262 (≠ V313), L283 (= L334), G305 (= G356), N335 (≠ L385), L338 (≠ T388)
- binding flavin-adenine dinucleotide: V178 (vs. gap), S206 (≠ L255), W209 (≠ Y258), R307 (= R358), H332 (= H382), R334 (≠ T384), N335 (≠ L385), G336 (= G386), I337 (≠ W387), L338 (≠ T388)
- binding glycine: G249 (≠ Y300), Y251 (≠ V302), Y251 (≠ V302), A264 (≠ G315), R307 (= R358), R334 (≠ T384), R334 (≠ T384)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 68% coverage: 122:418/436 of query aligns to 77:368/370 of 4yshA
- active site: I262 (≠ V313), L283 (= L334), G305 (= G356), N335 (≠ L385), L338 (≠ T388)
- binding flavin-adenine dinucleotide: V178 (vs. gap), S206 (≠ L255), G207 (= G256), W209 (≠ Y258), R307 (= R358), H332 (= H382), R334 (≠ T384), N335 (≠ L385), G336 (= G386), I337 (≠ W387)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
24% identity, 93% coverage: 2:405/436 of query aligns to 1:348/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L8), G8 (= G9), G10 (= G11), V11 (= V12), I12 (= I13), V30 (= V31), E31 (≠ D32), K32 (≠ R33), E38 (= E40), A39 (≠ T41), S40 (= S42), A43 (≠ N45), G45 (= G47), L46 (≠ Q48), V171 (≠ I226), G200 (≠ L255), G201 (= G256), W203 (≠ Y258), G298 (= G356), R300 (= R358), P301 (= P359), Y326 (≠ G383), R327 (≠ T384), N328 (≠ L385), G329 (= G386), I330 (≠ W387)
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
23% identity, 75% coverage: 90:418/436 of query aligns to 54:387/403 of 2gagB
- active site: A61 (≠ L95), T64 (≠ C98), T65 (= T99)
- binding flavin-adenine dinucleotide: G58 (vs. gap), N59 (≠ Q93), M60 (= M94), R62 (= R96), N63 (= N97), T64 (≠ C98), I66 (≠ A100), V195 (≠ I226), G224 (≠ L255), A225 (≠ G256), H227 (≠ Y258), L231 (= L262), L246 (= L275), G352 (= G383), T353 (= T384), G354 (≠ L385), G355 (= G386), F356 (≠ W387), K357 (≠ T388)
- binding flavin mononucleotide: A61 (≠ L95), R62 (= R96), H171 (≠ C202), V250 (≠ T281), E278 (≠ G315), R321 (≠ S352), W323 (= W354)
- binding 2-furoic acid: T64 (≠ C98), I66 (≠ A100), R68 (= R102), M263 (≠ I295), Y270 (≠ F307), K357 (≠ T388)
- binding sulfite ion: K170 (≠ D201), K276 (≠ V313)
Sites not aligning to the query:
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 72% coverage: 106:418/436 of query aligns to 54:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ S293), Y252 (≠ V302), Y267 (≠ A317), R308 (= R358), R334 (≠ T384), I335 (≠ L385)
- binding flavin-adenine dinucleotide: A174 (vs. gap), A203 (≠ L255), W206 (≠ Y258), I228 (≠ S279), Y252 (≠ V302), R308 (= R358), S333 (≠ G383), R334 (≠ T384), I335 (≠ L385), G336 (= G386), V337 (≠ W387), Q338 (≠ T388)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
27% identity, 72% coverage: 106:418/436 of query aligns to 54:368/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (vs. gap), A203 (≠ L255), W206 (≠ Y258), G226 (= G277), G306 (= G356), R308 (= R358), S333 (≠ G383), R334 (≠ T384), I335 (≠ L385), G336 (= G386), V337 (≠ W387), Q338 (≠ T388)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
23% identity, 75% coverage: 90:418/436 of query aligns to 56:389/405 of P40875
- C146 (≠ E178) mutation to S: No change in activity.
- H173 (≠ C202) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ M204) mutation to A: No effect on FMN binding and activity.
- C195 (≠ Q224) mutation to S: No change in activity.
- C351 (≠ T380) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 74% coverage: 95:418/436 of query aligns to 44:368/374 of 1y56B
- active site: F44 (≠ L95), G47 (≠ C98), T48 (= T99), H224 (≠ L280), P239 (≠ I295), G305 (= G356), M338 (≠ T388)
- binding flavin-adenine dinucleotide: R45 (= R96), C46 (≠ N97), G47 (≠ C98), G49 (≠ A100), E170 (≠ D225), V171 (≠ I226), T200 (≠ L255), N201 (≠ G256), W203 (≠ Y258), G305 (= G356), Y306 (≠ L357), Y307 (≠ R358), G334 (≠ T384), H335 (≠ L385), G336 (= G386), F337 (≠ W387), M338 (≠ T388)
- binding flavin mononucleotide: F44 (≠ L95), R45 (= R96), I260 (≠ M316), R301 (≠ S352), W303 (= W354)
Sites not aligning to the query:
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
29% identity, 35% coverage: 248:401/436 of query aligns to 195:346/369 of S5FMM4
- S202 (≠ L255) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W387) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L397) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
26% identity, 36% coverage: 248:405/436 of query aligns to 195:350/369 of O31616
- H244 (≠ Y300) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R358) binding
- 327:333 (vs. 382:388, 29% identical) binding
- R329 (≠ T384) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
23% identity, 62% coverage: 138:407/436 of query aligns to 105:377/404 of 3ad8B
- active site: G326 (= G356), K358 (≠ T388)
- binding flavin-adenine dinucleotide: V196 (≠ I226), G225 (≠ L255), A226 (≠ G256), H228 (≠ Y258), L247 (= L275), G353 (= G383), T354 (= T384), G355 (≠ L385), G356 (= G386), F357 (≠ W387), K358 (≠ T388)
- binding flavin mononucleotide: H172 (≠ C202), V251 (≠ T281), E279 (≠ G315), R322 (≠ S352), W324 (= W354)
- binding pyrrole-2-carboxylate: M264 (≠ I295), Y271 (≠ F307), T354 (= T384), K358 (≠ T388)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
23% identity, 62% coverage: 138:407/436 of query aligns to 105:377/404 of 3ad7B
- active site: G326 (= G356), K358 (≠ T388)
- binding flavin-adenine dinucleotide: V196 (≠ I226), G225 (≠ L255), A226 (≠ G256), H228 (≠ Y258), L247 (= L275), G353 (= G383), T354 (= T384), G355 (≠ L385), G356 (= G386), F357 (≠ W387), K358 (≠ T388)
- binding flavin mononucleotide: H172 (≠ C202), V251 (≠ T281), K277 (≠ V313), E279 (≠ G315), R322 (≠ S352), W324 (= W354)
- binding [methylthio]acetate: M264 (≠ I295), Y271 (≠ F307), T354 (= T384), K358 (≠ T388)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
23% identity, 62% coverage: 138:407/436 of query aligns to 106:378/405 of Q50LF2
- K172 (≠ D201) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C202) modified: Tele-8alpha-FMN histidine
- V197 (≠ I226) binding
- H270 (≠ T305) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ F307) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G383) binding
- G357 (= G386) binding
- K359 (≠ T388) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
27% identity, 36% coverage: 248:405/436 of query aligns to 195:350/364 of 3if9A
- binding flavin-adenine dinucleotide: S202 (≠ L255), G203 (= G256), W205 (≠ Y258), F209 (≠ L262), G300 (= G356), R302 (= R358), H327 (= H382), F328 (≠ G383), R329 (≠ T384), N330 (≠ L385), G331 (= G386), I332 (≠ W387)
- binding glycolic acid: Y246 (≠ K301), R302 (= R358), R329 (≠ T384)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 173, 174
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
26% identity, 36% coverage: 248:405/436 of query aligns to 195:350/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V302), R302 (= R358), R329 (≠ T384)
- binding flavin-adenine dinucleotide: S202 (≠ L255), G203 (= G256), W205 (≠ Y258), F209 (≠ L262), G300 (= G356), R302 (= R358), H327 (= H382), R329 (≠ T384), N330 (≠ L385), G331 (= G386), I332 (≠ W387)
- binding phosphate ion: R254 (= R310)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
23% identity, 62% coverage: 138:407/436 of query aligns to 105:377/402 of 1vrqB
- active site: G326 (= G356), K358 (≠ T388)
- binding n,n-dimethylglycine: K358 (≠ T388)
- binding flavin-adenine dinucleotide: V196 (≠ I226), A224 (= A254), G225 (≠ L255), H228 (≠ Y258), L247 (= L275), G353 (= G383), T354 (= T384), G355 (≠ L385), G356 (= G386), F357 (≠ W387), K358 (≠ T388)
- binding flavin mononucleotide: H172 (≠ C202), V251 (≠ T281), E279 (≠ G315), R322 (≠ S352), W324 (= W354)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
Query Sequence
>PfGW456L13_812 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_812
MKMRVMVLGSGVIGTTSAYYLARAGFEVVVVDRQPAAAMETSFANAGQVSPGYASPWAAP
GVPLKAIKWLLQRHAPLAIKATADIDQYLWMAQMLRNCTASRYAVNKERMVRLSEYSRDC
LDELRAETGIAYEGRSLGTTQLFRTQAQLDGAAKDIAVLKESGVPFELLDREGIARVEPA
LASVTDILAGALRLPNDQTGDCQMFTTKLAEMAANLGVQFRFGQDIQRLDFAGDRINGVW
IDGKLETADRYVLALGSYSPQLLKPLGIKAPVYPLKGYSLTVPITNPAMAPTSTILDETY
KVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMIVNDLYPQGGNLAEASFWTGLRPT
TPDGTPIVGATPFKNLFLNTGHGTLGWTMACGSGRLLADLMAKRKPQISAEGLDISRYGN
KTQESAKHVSPAPAHQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory