Comparing PfGW456L13_88 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_88 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
73% identity, 97% coverage: 1:172/177 of query aligns to 1:172/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
74% identity, 95% coverage: 5:172/177 of query aligns to 4:171/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
74% identity, 95% coverage: 5:172/177 of query aligns to 3:170/170 of 2j8rA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
64% identity, 96% coverage: 5:174/177 of query aligns to 5:173/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
64% identity, 96% coverage: 5:174/177 of query aligns to 3:171/171 of Q8ZPD3
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
56% identity, 93% coverage: 1:165/177 of query aligns to 2:165/165 of 4jwpA
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
44% identity, 88% coverage: 16:171/177 of query aligns to 22:177/180 of 2jlmF
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
42% identity, 91% coverage: 5:165/177 of query aligns to 5:164/165 of 4mbuA
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
38% identity, 95% coverage: 1:168/177 of query aligns to 1:168/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
39% identity, 93% coverage: 5:168/177 of query aligns to 6:170/181 of 5dwnA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
36% identity, 95% coverage: 5:173/177 of query aligns to 4:171/179 of 5wphA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
36% identity, 95% coverage: 5:173/177 of query aligns to 4:171/176 of 6m7gA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
32% identity, 92% coverage: 5:166/177 of query aligns to 4:163/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
32% identity, 92% coverage: 5:166/177 of query aligns to 3:162/173 of 5t7dA
>PfGW456L13_88 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_88
MTYHIRDAVHADLPAIRDIYNDAVLNTTAIWNEQAVDLGNRQAWFSARQSQAYPILVIVD
ADDTVLGYASFGDWRPFDGFRHTVEHSVYVRSDQRGNGLGPKLMDVLIERARDCGKHVMV
AAIESGNAASIRLHERIGFITTGQMPQVGTKFGRWLDLTFMQLTLNPGAQPPAANKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory